KEGG   Tribolium castaneum (red flour beetle): 664511
Entry
664511            CDS       T01046                                 

Definition
(RefSeq) ephrin-B1
  KO
K05463  ephrin-B
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    664511
   04052 Cytokines and growth factors [BR:tca04052]
    664511
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   664511
Cytokines and growth factors [BR:tca04052]
 Growth factors
  Growth factors (RTK binding)
   664511
SSDB
Motif
Pfam: Ephrin DUF1082
Other DBs
NCBI-GeneID: 664511
NCBI-ProteinID: XP_008195992
UniProt: D6WRM8
LinkDB
Position
LG7
AA seq 266 aa
MVWQPSSVLVNGLILLTFSLHSFVTATNPSSAKFYTIHWNSSNPIFRIDNTDNVIDVNRY
NLKFEYDQVNLICPVYVPGTRDEEMEKYIIYNVSKDEYDTCRITNPNPRIIAVCDKPYKL
MYFTITFRPFTPQPGGLEFLPGHDYYFISTSTSDDLHRRIGGRCTTHNMKIVFKVWGPAQ
TSPPPAPATVSRWWPVTSPRSTSTSSTTTTTSTPPPVTTTKKSKTYGGKHPNEVGKSEEL
TLGGGAAVGPVQVLVVCAVAVLLAMR
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtctggcaaccgagcagtgtccttgtcaacggcctgatcctgctaacgttcagccta
cacagtttcgtcacggcaacgaaccccagcagcgccaagttctacaccatccactggaac
tcctcgaacccgatctttcgcatcgacaacaccgacaacgtgatcgacgtgaaccgctac
aacctgaagttcgagtacgaccaggtgaacctcatctgccccgtgtacgtcccgggcacc
cgcgacgaggagatggagaagtacatcatctacaacgtgtccaaggacgagtacgacacg
tgccgcataacgaaccccaacccgcgcatcattgccgtctgtgacaaaccgtataagtta
atgtacttcaccataacgttccggccgttcacgccgcagccggggggcctggagttcctc
cccgggcacgactactacttcatctcgacgtcgaccagcgacgacctgcaccggcgaata
ggcggccggtgcacgacgcacaacatgaagatcgtgttcaaggtgtgggggcccgcgcag
acgtcgccgccgcccgcgcccgccaccgtctcgcggtggtggcccgtcacgtcgccgcgc
tccacctccacgagctcgacgacgacgacgaccagcacgccgccgccggtcacgacgacg
aagaagtccaagacctacggcggcaagcaccccaacgaggtcggcaagagcgaggaactc
acgctcggcggcggcgccgccgtcgggccggtgcaagtgctggtggtgtgtgcggtcgcg
gtgctgctcgcgatgcgatga

DBGET integrated database retrieval system