KEGG   Tatumella citrea: A7K98_19470
Entry
A7K98_19470       CDS       T04873                                 

Definition
(GenBank) oligopeptidase A
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
tci  Tatumella citrea
Brite
KEGG Orthology (KO) [BR:tci00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tci01002]
    A7K98_19470
Enzymes [BR:tci01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     A7K98_19470
Peptidases and inhibitors [BR:tci01002]
 Metallo peptidases
  Family M3
   A7K98_19470
SSDB
Motif
Pfam: Peptidase_M3
Other DBs
NCBI-ProteinID: ARU95703
UniProt: A0A1Y0LCF4
LinkDB
Position
complement(4141758..4143800)
AA seq 680 aa
MTNPLLTSFTLPPFSLIKPEHVVPAVTQALQDCRATVEKVVAQGGPYTWKTLCEPLSETD
DRLGRLFSPVSHLNSVKNSPELREAYEQVLPLLSEYGTWVGQHEGLYQAYVSLKQGDSYA
SLNTAQKKAVDNALRDFELSGIGLPKDKQQRYGEIASRLSEIGAAYSNNVLDATMGWSKL
ITDESELAGMPESALAAAKAQAEAKEQQGWLLTLDIPSYLPVMTYCENQALREEMYRAYS
TRASDQGPNAGKWDNGPLIEEELALRHEFAQLLGFGSFAEKSLATKMAKSPQHVLDFLAD
LAKRARPQGEKELAQLREFAKTHYNVDTLEPWDITFYAEKQKQHLYTISDEQLRPYFPEN
KAVSGLFEVVKRIYGITAKERKDIDVWHPDVRFFELYDETGELRGSFYLDLYAREHKRGG
AWMDDCVGRMRKADGSLQKPVAYLTCNFNRPLNGKPALFTHDEVITLFHEFGHGLHHMLT
EIETAGVSGISGVPWDAVELPSQFMENWCWEPEALAFISGHYETGEPLPQELLEKMLAAK
NYNAAMFILRQLEFGLFDFRLHAEYDPAKGARLLETLQEVKKQVSVVPSPSWGRFPHAFS
HVFAGGYAAGYYSYLWADVLAADAYSRFEEEGIFNRETGQSFLDNILSRGGSEEPMVLFS
RFRGREPQLDAMLEHYGIQG
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgactaacccgttactgacctcgttcacactgccgccgttttcgttgattaagcctgaa
catgttgttccggcggtcactcaggcactgcaggactgtcgtgcaactgtcgaaaaagta
gtagcacagggcggtccctacacctggaaaacgttatgtgagccgctgtctgagaccgat
gaccgactgggccgattgttttcaccggtcagccatcttaactcggtgaaaaacagccct
gaattgcgcgaagcttatgagcaggtactgccattattatcagaatatggcacctgggta
ggacagcatgaaggtctgtatcaggcgtatgtcagtctgaaacagggtgacagctatgcc
tctctgaataccgcacagaaaaaagcggtagataacgcactgcgtgattttgagttatcc
ggtatcggtttgcctaaagacaaacagcaacgctatggcgagattgcctcccggctgtca
gaaatcggcgcggcctacagcaataatgtgctggatgcgaccatgggctggagcaaactg
atcaccgatgaaagcgagctggccggaatgccggaaagcgcactggccgccgccaaagcg
caggctgaagctaaagaacaacaaggctggctgttgacgctggatattcccagctacctg
ccggtgatgacctactgtgaaaaccaggcactgcgtgaagagatgtaccgtgcttacagc
acccgtgcatcagaccaggggccgaatgccggcaaatgggataatggcccgctgatcgaa
gaagaacttgcgctgcgccacgagttcgctcagctgttaggtttcggttcattcgctgaa
aaatcgctggcgaccaaaatggcgaaatcgccacaacatgtactggatttcctggctgat
ctggcaaaacgtgcacggccacagggtgagaaagaactggctcagctgcgtgagtttgcg
aaaacccactataacgtcgatacgctggaaccgtgggatattactttctacgccgagaag
caaaaacagcatttgtataccattagcgacgaacagttgcgcccttacttcccggaaaat
aaagcggtcagtggcctgtttgaagtggtgaaacgcatttacggaatcaccgccaaagag
cgcaaggatattgatgtctggcatccggatgtgcgtttctttgaactgtatgatgaaacc
ggtgaattgcgcggcagtttctatctggatctgtatgcgcgtgagcacaaacgcggcggt
gcgtggatggatgactgtgtcggacggatgcgtaaagccgatggttcactgcaaaaacca
gttgcctacctgacctgtaactttaaccggccattaaatggcaaaccggcactgtttact
catgatgaagtgattactctgttccatgagttcgggcatggtctgcaccatatgctgact
gaaatcgaaacagccggtgtatccggaatcagtggtgtgccatgggatgccgtcgagctg
ccaagccagtttatggaaaactggtgctgggagccggaagcactggcatttatctccggg
cattatgaaaccggagagccgttacctcaggaattgctggagaaaatgctggcagcgaaa
aattataatgccgctatgtttatcctgcgtcagctggagttcggtctgtttgacttccgc
ctgcatgctgaatatgacccggcaaaaggcgctcgtttgctggaaaccctgcaggaagtg
aaaaagcaggtatcagttgtgccgtcaccatcctggggacgtttcccgcatgccttcagc
catgtgtttgccggaggttacgcggcgggctactacagctatctgtgggcagatgtgtta
gcggcagatgcctactcacgttttgaagaggaaggtatttttaaccgcgaaactggtcag
tcattcctcgacaatatcctgagccgcggtggttctgaggagccaatggtcctgttcagc
cgtttccgtggtcgcgaaccacaactggatgcgatgctggagcattacggtatccaggga
taa

DBGET integrated database retrieval system