KEGG   Thauera chlorobenzoica: Tchl_0142Help
Entry
Tchl_0142         CDS       T04612                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tcl  Thauera chlorobenzoica
Pathway
tcl00970  Aminoacyl-tRNA biosynthesis
tcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tchl_0142
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tcl03029]
    Tchl_0142
Enzymes [BR:tcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Tchl_0142
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Tchl_0142
Mitochondrial biogenesis [BR:tcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Tchl_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APR03018
UniProt: A0A1H5YP33
LinkDB All DBs
Position
complement(149754..151229)
Genome map
AA seq 491 aa AA seqDB search
MINASLTELRRALDHGQISSVELATLFLDRIDALNPQLNAFITVDRDGALAAARAADARL
AAGRGGALAGIPLAHKDVFCTEGVLTTCASKMLANFVSPYDAHVVSLLKAAGAVSLGKTN
MDEFAMGSSNESSWYGPVKNPWHPERVPGGSSGGSAAAVAARLAPIATGTDTGGSVRQPA
AFCGITGIKPTYGTVSRYGMIAYASSLDQGGAFGASAEDCALLLSAMTGFDARDSTSLER
PAEDYAAALAASAPGAKPLAGLTIGLPREFFAEGMADDVRAAVDAALDAYRALGATTVEV
SLPNAKLAIPAYYVIAPAEASSNLSRFDGVRYGHRAAGYGDLADMYSKSRAEGFGAEVKR
RILVGTYVLSHGYYDAYYLQAQRLRRLIAQDFQAALQQCDLIAGPTTPTPAWALGQMADD
PVQMYLSDIYTIAVNLAGLPGLSHPAGFGAEGLPIGLQLVGDYFAEARLLNAAHQYQHAT
DWHLRRPACAA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgcctccctcaccgaactgcgccgcgcgctcgaccacgggcagatttccagc
gtcgagctcgcgaccctgttcctcgaccgcatcgacgccctcaacccgcagctcaacgcc
ttcatcaccgtcgaccgcgacggcgccctcgccgccgcgcgtgccgccgacgcgcgcctc
gccgccggccggggcggggcgctcgccggcatcccgcttgcgcacaaggacgtgttctgc
accgaaggcgtgctcaccacctgcgcctcgaagatgctggcgaacttcgtcagcccttac
gacgcccacgtcgtgagcctgctcaaggccgccggcgcggtgagcctgggcaagaccaac
atggacgagttcgcgatgggctcgtcgaacgaaagctcctggtacggcccggtgaagaac
ccgtggcaccccgaacgcgtgcccggcggctcctccggcggctcggccgcggcggtcgcc
gcgcgcctggcgccgatcgccaccggcaccgacaccggcggctcggtgcgtcagccggcg
gcgttctgcggcatcaccgggatcaagccgacctacggcacggtgagccgctacggcatg
atcgcctatgcttcatccctcgaccagggtggcgctttcggcgcctcggccgaagactgc
gcgctgctgctgtcggcgatgaccggcttcgacgcgcgcgactcgaccagcctcgagcgc
cccgccgaagactacgccgccgccctcgccgcctccgccccgggggcgaaaccgctcgcc
ggcctcaccatcggcctgccgcgcgagttcttcgccgaaggcatggccgacgacgtgcgc
gccgcggtcgatgccgcgctcgacgcgtaccgcgccttgggcgcgaccacggtcgaggtc
tcgctgcccaacgcgaagctggcgattcccgcctactacgtgatcgcgccggccgaagct
tcgagcaacctcagccgcttcgacggcgtgcgctacggccaccgcgccgccggctacggc
gacctcgccgacatgtacagcaagagccgtgcggagggcttcggtgccgaagtcaagcgc
cgcatcctggtcggcacctacgtgctgtcgcacggttactacgacgcctactacctgcag
gcgcagcgcctgcgccggctgatcgcgcaggatttccaggccgcattgcagcagtgcgac
ctgatcgccgggccgaccaccccgacccccgcctgggcgctcggccagatggccgacgac
ccggtgcagatgtacctgtccgacatctacacgatcgcggtcaacctcgccggcctgccc
ggcctgtcgcaccctgccggtttcggcgccgagggcctgccgatcggcctgcagctggtc
ggcgactacttcgccgaggcccgcctgctcaacgccgcgcaccagtaccagcacgccacc
gactggcacctgcgccgtccggcctgcgcggcctga

DBGET integrated database retrieval system