Thioclava electrotropha: AKL02_004570 Help Entry AKL02_004570      CDS       T06997                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tec  Thioclava electrotropha Pathway tec01100   Metabolic pathways tec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AKL02_004570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AKL02_004570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPZ90226 LinkDB All DBs Position 918794..919036 Genome browser AA seq 80 aa AA seqDB search MTEDEIRSAYIEELVRVAPDLDPAEIAGSDHLQDDLELDSMDILNLVIALNQRFGVAIAE ADYPQIATPDLAAAFLAKRV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccgaagacgaaatccgcagcgcctatatcgaggaactcgtgcgcgtcgcccccgat ctcgatcccgccgaaatcgcgggatcggaccatcttcaggacgatctcgagctcgactcg atggatatcctgaacctggtgatcgcgctcaaccagcgcttcggcgtcgcgattgcagag gcggattatccccagatcgccacaccggatcttgctgcggcgtttctagccaagcgggtt tga

DBGET integrated database retrieval system