KEGG   Thermococcus gammatolerans: TGAM_0072
Entry
TGAM_0072         CDS       T00920                                 

Definition
(GenBank) Zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tga  Thermococcus gammatolerans
Pathway
tga00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TGAM_0072
Enzymes [BR:tga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TGAM_0072
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TGAM_0072
    1.1.1.-  
     TGAM_0072
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc DAO 2-Hacid_dh_C Pyr_redox_3 Pyr_redox Pyr_redox_2 TrkA_N
Other DBs
NCBI-ProteinID: ACS32574
UniProt: C5A2S2
LinkDB
Position
65424..66497
AA seq 357 aa
MHEMLAVRWHGRRDLRLEDIPEPQVKPGFIKIKVKACGICGTDLNEYLNGPIFIPTERPH
PLTGRTAPVTIGHEFAGEVVEIGEGVKGFEVGDRVAIFPVIHCGECYFCRRGMENLCVNF
GVTGLSEDGGFAEYALVRPYQAYKIPESVSFEEAALVEPLSVGVRAVKKAGLLPGDSVVI
IGAGPIGLSVLLVARASGAGKVIVVEPSRVRRKKALELGADIAIDPSGRSTEEVVDEIVG
ETELGADVSFECVGLNETFKTAVESIRKGGRAVILGVFKCLTSFNAKGLVVGEKSIVGSV
SHSADDFCRGISLIASGRVDVGPMITSRVGLEEIIERGFEELAKNREGHVKILAVGK
NT seq 1074 nt   +upstreamnt  +downstreamnt
gtgcatgaaatgctcgcggtcaggtggcacggaaggagggatctgaggcttgaggacatc
cccgagccccaagttaagccgggcttcatcaaaatcaaagtgaaagcctgtggaatatgc
ggaaccgacctgaacgagtacctcaacggaccgattttcatacccaccgagaggccccac
cctctcactggcagaactgctccagtaacgatagggcacgagttcgctggggaggtcgtt
gaaattggcgagggcgttaagggctttgaagtcggggacagagttgctatcttcccggta
atccactgcggtgagtgctacttctgcaggaggggaatggagaacctctgcgtgaacttt
ggggttacgggcctcagcgaggacgggggttttgcagaatatgccctggtcagaccatat
caggcctacaaaatccccgaaagcgtttcgttcgaggaggccgcgttggtcgagcccctc
tcagtcggggtgagggcggtcaaaaaggccggcctgttaccgggggacagcgtggtgata
ataggagcgggtccgataggcctcagcgtgctcctcgttgcgagggcctccggggcggga
aaggtaatcgtcgtggagccctcaagggtgagacggaaaaaggccctcgagcttggtgct
gatattgcaatcgacccgagcggcaggagcacggaggaagtcgttgatgagatagtgggc
gaaactgaacttggagccgatgtcagcttcgagtgcgttgggctcaacgaaactttcaag
acggccgtcgagagcataaggaaaggcgggagggccgttatccttggggttttcaagtgc
ttgacgtccttcaacgcaaaaggcctcgtcgttggggagaaaagcatagtgggctcggtt
tcccacagcgcggatgacttctgcagggggatttccctcattgcatccgggagggttgac
gttgggcccatgataacctcaagagttgggcttgaggagataatcgagaggggctttgag
gagctcgcgaagaacagggaggggcacgttaagatactggccgtgggaaaataa

DBGET integrated database retrieval system