KEGG   Thermococcus gammatolerans: TGAM_0072Help
Entry
TGAM_0072         CDS       T00920                                 

Definition
(GenBank) Zinc-binding alcohol dehydrogenase
Organism
tga  Thermococcus gammatolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc DAO 2-Hacid_dh_C Pyr_redox_3 Pyr_redox TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACS32574
UniProt: C5A2S2
LinkDB All DBs
Position
65424..66497
Genome map
AA seq 357 aa AA seqDB search
MHEMLAVRWHGRRDLRLEDIPEPQVKPGFIKIKVKACGICGTDLNEYLNGPIFIPTERPH
PLTGRTAPVTIGHEFAGEVVEIGEGVKGFEVGDRVAIFPVIHCGECYFCRRGMENLCVNF
GVTGLSEDGGFAEYALVRPYQAYKIPESVSFEEAALVEPLSVGVRAVKKAGLLPGDSVVI
IGAGPIGLSVLLVARASGAGKVIVVEPSRVRRKKALELGADIAIDPSGRSTEEVVDEIVG
ETELGADVSFECVGLNETFKTAVESIRKGGRAVILGVFKCLTSFNAKGLVVGEKSIVGSV
SHSADDFCRGISLIASGRVDVGPMITSRVGLEEIIERGFEELAKNREGHVKILAVGK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgaaatgctcgcggtcaggtggcacggaaggagggatctgaggcttgaggacatc
cccgagccccaagttaagccgggcttcatcaaaatcaaagtgaaagcctgtggaatatgc
ggaaccgacctgaacgagtacctcaacggaccgattttcatacccaccgagaggccccac
cctctcactggcagaactgctccagtaacgatagggcacgagttcgctggggaggtcgtt
gaaattggcgagggcgttaagggctttgaagtcggggacagagttgctatcttcccggta
atccactgcggtgagtgctacttctgcaggaggggaatggagaacctctgcgtgaacttt
ggggttacgggcctcagcgaggacgggggttttgcagaatatgccctggtcagaccatat
caggcctacaaaatccccgaaagcgtttcgttcgaggaggccgcgttggtcgagcccctc
tcagtcggggtgagggcggtcaaaaaggccggcctgttaccgggggacagcgtggtgata
ataggagcgggtccgataggcctcagcgtgctcctcgttgcgagggcctccggggcggga
aaggtaatcgtcgtggagccctcaagggtgagacggaaaaaggccctcgagcttggtgct
gatattgcaatcgacccgagcggcaggagcacggaggaagtcgttgatgagatagtgggc
gaaactgaacttggagccgatgtcagcttcgagtgcgttgggctcaacgaaactttcaag
acggccgtcgagagcataaggaaaggcgggagggccgttatccttggggttttcaagtgc
ttgacgtccttcaacgcaaaaggcctcgtcgttggggagaaaagcatagtgggctcggtt
tcccacagcgcggatgacttctgcagggggatttccctcattgcatccgggagggttgac
gttgggcccatgataacctcaagagttgggcttgaggagataatcgagaggggctttgag
gagctcgcgaagaacagggaggggcacgttaagatactggccgtgggaaaataa

DBGET integrated database retrieval system