KEGG   Toxoplasma gondii: TGME49_312260Help
Entry
TGME49_312260     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 7895603
NCBI-ProteinID: XP_002364448
UniProt: A0A125YNP4
LinkDB All DBs
Position
XI:complement(join(2549114..2550042,2550941..2551127,2551614..2552625,2553016..2553635))
Genome map
AA seq 915 aa AA seqDB search
MAASTLADSKGRQPASQAQELPQQREERSSAGSQATCKQTASASSASVASASVASASVAS
ASSASASSASVASASVASASSASGASSACSVPALVLASLLPAAAHLERCYSVCCTGTHVF
VGGGSISGFVCVWKLPGDLLSEFVAQQSDGDRGTEAAPLHARAVHTRGKEKSAEWQFVGV
LGSMVSPVVQLKLNSTRERLAAVTQSSIGYIWDVSPAALSSLSALSASANVALSSFESLT
SCSSLPSWLADVFAGDSAQSSSPPTQSKTALPASVSHLLHAGPKPVAVLGGSESPANVAC
VEFLPDGAMLAAGSSVPLSVDQVGREGAACRAPLSLYHCESGQRIAEFPGFVFSGKKTSH
APRAPLLLSSIAAVAMDPHKFVPPLPTDASTSRSASRWLAAGDAVCGCVALLLLPDGLLM
QLRRQHESLLHAWNEKETRRLGLHQLRRRRDEASLAAAAQRESTPADAEPGEKERMQKLE
EAAAEAEKAYQAALAEAAAAGDDVKDRDEEDENFDERNPMPFVQPVLLNLPTVVAQLSEA
APVEMTSMAWRPRRQGHRGSLHLYVACTDGFVRILQLNPVAVDASSQHTLQVRSTVLCKV
ASGTCAGDVRSLICLRPYSRRGHLTVAACNAFDFTSFASFASALPALSDAPPDPQDGAES
SSKDNGSSAFYQVRVVEGLGEAGDEIAACIHCHADFICGVAASPSGVVVVSLAADKRLAV
YLRSEAVQDRLKKDEEEKKRREAEEKRRREAEEEEKRRREAEEEEKRRREAEEEEKRRRE
AEEEKRRREAEEEEKRRREAEEAQRLEDTATESKTESERMSHAEEGGDPGINAAGEEEPR
EFGQAKLGEVTAQADEMRDEGEGEEERPSRRKGDTLDNEAEGGSSPKRLKASLSPAEDAE
EHLPEGDEDDLFGEE
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcgacactggccgactcaaagggtcgccagcctgcctctcaggctcaggaa
ctcccccagcaaagagaggaacgctcctctgcgggaagccaggctacttgcaagcaaacc
gcttctgcttcctctgcttctgttgcttctgcttctgttgcttctgcttctgttgcttct
gcttcctctgcttctgcttcctctgcttctgttgcttctgcttctgttgcttctgcttcc
tctgcttctggtgcttcgtctgcctgctcggtgcccgctctcgttttagcttccttgctt
cctgcagctgcacatctcgagcggtgctacagcgtctgctgtacaggcacacatgtgttt
gtgggcggaggcagcatttccggtttcgtttgcgtctggaagcttcccggcgacctcctc
agcgaattcgttgcccagcagagcgacggcgacagaggcaccgaggcggcgccgctgcat
gcacgcgctgtccatacacgcgggaaagagaaatccgcagaatggcagtttgtcggcgtc
ctcggttccatggtgtcgcccgtcgttcagctgaaactcaacagcactcgcgagcgactc
gcggccgtcacacaatcctcaatcggctacatttgggacgtgagtccggcggctctctct
tctctgtccgccttgtctgcgtcggcgaatgtcgctctttcttccttcgagagtttaacg
tcttgctcttccctgccctcttggctggcagatgtcttcgcgggagactctgctcaaagc
tcctctccgcccactcagtccaaaacggcgctgcctgcctccgtcagccatctactgcat
gctgggccgaagccggtggcggttctgggaggctcggagtcgcctgcaaacgtcgcatgc
gtcgaattcctccccgatggcgccatgctcgctgcaggcagcagcgtacctctctcagtt
gaccaagtcggccgcgaaggcgctgcctgtcgagcgccgctaagcctgtaccactgcgag
tctggccaacgcattgcggagttccccggcttcgttttctccggaaagaaaacttctcac
gcgcctcgtgctcctctcctcctctccagcatcgccgcggttgccatggacccccacaag
tttgtgccgcctctcccaaccgacgcttctacttctcgctccgcaagtcgctggctggct
gcgggggacgcggtgtgcggctgtgtggctttgcttctgcttcccgatggcttgttgatg
caactgcggagacaacatgagagtcttctgcatgcgtggaatgaaaaagaaacgagacgt
ctgggcctgcaccagcttcgacgcagacgcgacgaggcctctctcgctgccgctgctcag
cgcgaatccacgcctgcagacgctgagcctggggagaaagaacgcatgcagaaactcgag
gaggcggcggcggaggcggaaaaggcctaccaagcagccctcgcagaggcggctgcggct
ggagatgacgtcaaggatcgcgacgaagaagacgagaatttcgacgaaagaaatccgatg
ccgttcgtacaacctgttctcctcaaccttccaaccgtcgtcgcgcaactcagtgaagct
gctccagtagagatgacgtctatggcttggcggccgcggcggcagggacatcgcggctct
ctccatctctacgtcgcatgcaccgacggcttcgtccgcatccttcaactgaatccggtg
gcagtggacgcatcctctcagcacacccttcaagttcgaagcactgtcctctgcaaagtt
gccagcggaacttgcgccggggatgttcgttcgctgatttgtcttcggccgtactcgcgt
cgtggacacctgaccgtggctgcatgcaacgctttcgatttcacctcgtttgcgtccttt
gcctccgcgttgccggctctctcggacgcgccgcctgacccccaggacggcgcggagagt
tcttcgaaagacaacggatcttctgcgttctaccaagttcgcgtcgtcgaaggcctaggc
gaagccggcgacgagatcgctgcatgcattcactgtcatgcagacttcatttgcggtgtc
gccgcttcaccctcgggtgtcgttgtcgtctctctcgctgccgacaaacgccttgctgtg
tacctgcgctccgaggctgtccaggatcgcctgaagaaggacgaggaagagaagaagaga
cgagaagcagaagagaagaggaggagagaagccgaagaagaggagaagcggaggagagaa
gctgaagaagaggagaagcggaggagagaagccgaagaagaggagaagcggaggagagaa
gcagaagaggagaagcggaggagagaagccgaagaagaggagaagcggaggagagaagca
gaagaggcacagcgcctggaagacaccgcgacagagtcgaagacagagtcggagaggatg
agccatgcagaggagggaggagacccagggattaacgcggcgggggaagaggaaccaaga
gagttcggacaggcaaaactgggggaagtgactgcgcaagcggacgagatgcgggacgag
ggtgagggagaagaagagagaccaagtaggcggaaaggagacactttagacaacgaggca
gagggaggaagttccccgaagagactgaaagcgagtttgtcgccagcggaagacgcagag
gaacatctccccgaaggagacgaagatgacctctttggagaggaataa

DBGET integrated database retrieval system