KEGG   Taeniopygia guttata (zebra finch): 100219856
Entry
100219856         CDS       T01082                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04068  FoxO signaling pathway
tgu04217  Necroptosis
tgu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100219856 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100219856 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100219856 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tgu03000]
    100219856 (STAT3)
Transcription factors [BR:tgu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100219856 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 100219856
NCBI-ProteinID: XP_030111855
Ensembl: ENSTGUG00000002600
LinkDB
Position
27
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAESNAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctacagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagcttccccatggagctccggcagttcctggccccgtggattgaaagc
caggactgggcttacgctgccagcaaggagtctcacgccacgctggtgttccacaacctg
ctgggggagatcgaccagcagtacagccgctttctgcaggagtccaacgtcctctaccag
cacaacctgcgccgcatcaagcagttcctgcagagcagatacttggagaagccaatggaa
atagctcgcatcgtggctcgctgcctctgggaagagtcccggctcctccagaccgctgcc
accgcagcccagcaagggggacaggcaacacatccaacagcagctgtggtgacagagaag
cagcagatgctggagcagcacctgcaggatgtcaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaagatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggacctgaacgggaacaaccagtcggtgacccggcagaagatg
cagcagctggagcaaatgctgacagcgctggaccagatgcgcaggggcatagtgagcgag
ctggctgggctgctgtcagccatggagtatgtgcagaagatgctggcagatgaggaactg
gcagactggaagaggcggcagcagattgcctgcattggtggcccacccaatatctgcctg
gaccggcttgagaactggataacctccctcgctgaatcgcagctacagacccggcagcag
atcaagaagttggaagaactgcagcaaaaagtatcctataagggtgacccaatcgtgcag
caccggcccatgctggaggagcggattgtggagctgttcaggaacctgatgaaaagtgct
tttgttgtggagaggcagccctgcatgcccatgcaccccgaccggccccttgtcatcaag
acaggtgtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggggatgttgcagcacttcggggg
tcccggaagtttaacatcctggggaccaacaccaaggtcatgaacatggaggagtcgaac
aacggcagcctctcagcagagttcaaacacctgaccctgcgggagcagcggtgtgggaat
ggaggccgagccaactgtgatgcctcgctgatagtcactgaggagctgcacctcatcacg
tttgagacagaggtgtatcaccaggggctgaagatcgacctggagacccactcgctgcct
gtggtggtcatctccaacatctgtcagatgcccaacgcctgggcgtctatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccacccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacaaagcgcgggctc
agcatcgagcagctgaccacgctggcagaaaaactgctgggaccaggtgtgaattactct
ggctgtcagatcacctgggccaagttttgcaaggagaacatggctggcaaaggcttctct
ttctgggtgtggctggacaacatcattgacttggtgaagaagtacatcctggcgctctgg
aacgaagggtacatcatgggcttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcccccggggacctttcttctgcgcttcagtgagagcagcaaggaaggaggcatcacc
ttcacgtgggtggagaaggacatcagtgggaagacgcagatccagtcggtggagccttac
accaagcagcagctgaacaacatgtcatttgcggagatcatcatgggctacaaaatcatg
gatgccaccaacatcctggtgtccccactggtgtacctgtacccagacatccccaaggag
gaggcgtttggaaagtactgccgctccgagagccaggaacactcggaagcgacggactca
ggtagtgctgctccgtacctgaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccatcgacctgcccatgtccccgcgcaccctggactcgctcatgcagttcggcaac
agcagcgagggcgcagagagcaacgcgggcgggcagttcgagtcgctgaccttcgacatg
gagctgaccccagagtgtgcgtcctcgcccatgtga

DBGET integrated database retrieval system