KEGG   Taeniopygia guttata (zebra finch): 100221799
Entry
100221799         CDS       T01082                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X3
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
tgu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100221799 (CACNA1E)
   04020 Calcium signaling pathway
    100221799 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tgu04040]
    100221799 (CACNA1E)
Ion channels [BR:tgu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100221799 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 100221799
NCBI-ProteinID: XP_030135485
LinkDB
Position
8
AA seq 2382 aa
MQNTHSCNLLEPQSLAQALVSRAASFDALYDGRCRDGEAQAGALQLGLGQLVPVSPDLIK
RRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGSGDGGSDQNRSRQG
APAPAGGSPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEENIVRKYAKKLID
WPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALG
FVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSL
QIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHP
CGVQGCPPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWN
WLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWI
DKAEEVMLAEENKNSGTSALDVLRRATIKRNRTDAMSGDEHCVDIASVGERRLAQRRRLN
PTLGNPSSQSGLKGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAI
VHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEV
VWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIV
VFALLGMQLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRS
GMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEV
SPMSAPNMPAIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQE
AINKDEPPLINPHASIFRRKRPGEGVTLEKCAEEQGKGEREGPEQPVPGANPGGGEDRTS
PRAKRDMWQQKSCHGNCEPGEQDGAGGSIEDRARMRQSQRRSRHRRARMEGKDTAGILGS
RSASQEMGLEEASTAEGAQDGDRRGDMAAAEALIPGEPEASGESIRTNGVPAGDADLLGT
AKKGSPPHAAPELSQGKTGTLTEQDCSSPDTSEQALLEPRRSVSRSEPDLSSITPNTEKA
TESTAIMIDVHDSAVVQISNKTDGEASPLKEAETKEDEEEMEKKKRKKEKSETGKAMVPH
SSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFD
YVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRD
IKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQL
FKGKFFYCTDSSKDTQKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVST
GEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQG
DKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIAL
NTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITV
IGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIML
SCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLT
RDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRL
VLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKM
LDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQE
IISNAKALPYLQQDTLSGLSSRGGFSSLSPLSPQEIFQLACMDPAQEQFQEHQSLEPEVR
EFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRPNS
SWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSGHRSEGHRSGRERGRSKERKHL
LSPDISRCNSEERSPQAQEESPERRRESRSPSEGRSQTPSRQGMGSLSESSIPSISDTST
PRRGRRQLPPVPPKPRPLLSYASMLRHAGDTSPPADESEGGSPLLSSSLDPSTAGPAESS
SSPVAGKQSRQSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAP
PLRHSWQMPNGHYRRRRRGAAQGVMCGASIDVLSDTEEDDKC
NT seq 7149 nt   +upstreamnt  +downstreamnt
atgcagaacacccattcctgcaacctgctggagccccagagcctggcccaggccctggtg
tcccgcgccgcctccttcgacgcgctctacgatggccgctgccgcgacggcgaggcgcag
gccggcgccctgcagctggggctgggccagctggtgcccgtcagccccgacctgatcaag
cgccgccggggagggctcatcgagcagagggacatcatcaaggcacacgaggcacacaag
atgcagagcacgccccaggcacggaggaaggagtgggagatggctcgctttggggaggca
gtggccggcaggctgggctccggagatgggggctccgaccagaaccggagccggcaagga
gctcctgcccctgcgggaggcagcccgggagccttcaagcaaaccaaagcgcagagagcc
cggactatggctctgtacaaccccatccccgtccggcagaactgcttcaccgtcaacaga
tcgctcttcctcttcggggaagagaacatagtcaggaaatacgccaagaagctcatcgac
tggcctcccttcgagtacatgatcctggcgaccatcattgccaactgcatcgtgctggcc
ctggagcagcacctccccgaggatgacaagacgcccatgtcacggagattagagaagaca
gagccctacttcattgggattttctgcttcgaggctgggattaagatcgtagccctgggg
ttcgttttccacaagggctcgtacctgcgcaacggctggaacgtcatggacttcatcgtg
gtcctcagcggcatcctcgccacggccgggacacacttcaacacccacgtggacctgcgg
acgctgcgcgccgtgcgcgtgctcaggcccctgaagctcgtctcgggcattcccagcttg
cagattgtcctgaaatccatcatgaaggccatggtgcctctcctgcagatcggcctgctg
ctcttttttgctatcctcatgtttgccatcatcggcctggagttctacagcgggaagctg
caccgagcctgctacacaaacaattcaggtgaactggaggagctggaccctccccatccc
tgcggggtgcagggttgccccccgggctacgagtgccgggagtggatcggtcccaacgac
gggatcacgcagttcgacaacatcctctttgctgtgctgaccgtcttccagtgcatcacc
atggaagggtggaccacagtcctgtacaacaccaatgatgccttaggagccacctggaac
tggctgtacttcatccccctcatcatcattggatccttcttcgtcctcaaccttgtcctg
ggagtgctgtcaggggagtttgccaaagagagagagcgcgtggagaaccgccgagccttc
atgaagctgcggcgccagcagcagatcgagcgggagctcaacggctaccgggcgtggata
gacaaagcggaggaagtcatgctggccgaagagaacaaaaattcggggacctcagcctta
gacgtgctcaggcgagccaccatcaagcggaaccgcacggatgccatgtcgggtgacgag
cactgtgtggacatcgcctccgtgggcgagcggaggctggcgcagaggagacgtcttaat
ccaaccttgggtaacccctcaagtcaatctggcctcaaaggtgccagggtggacggtgcc
tcctacttgcggcacaaggagcggctcctgcgcatctccgtccgccacatggtcaaatcc
caggtcttctactggattgtcctgagcctggtggctctcaacactgcctgcgtggccatc
gtccatcacaaccagccagcctggctcacccacttcctctactatgcagagttcctgttt
cttgggctcttccttctggagatgtccttgaagatgtacgggatggggccacgcctttac
ttccattcttccttcaactgcttcgactgtggggtcacagtgggaagcatcttcgaagtg
gtttgggctatattcaggccaggaacctcttttgggatcagtgttctacgagctcttcgt
ctcctgcggatatttaaaataaccaagtactgggcatccctgaggaatttggtggtctcg
ctgatgagctccatgaaatctatcatcagtctgctcttcctcctcttcctctttattgta
gtctttgccctgctgggaatgcagctgtttggaggcaggtttaacttcatggatgggact
ccctcggccaactttgacaccttccctgcagccatcatgacggtgtttcagatcctgaca
ggcgaggactggaacgaggtgatgtacaacggcatccgctcccagggaggtgtgcgctca
gggatgtggtcctccatctacttcatcgtcctcaccttgtttgggaactatactctgctg
aatgtcttcttggccattgccgtggacaacctggccaatgctcaggagctcaccaaggac
gagcaggaggaagaggaggcctttaaccagaagcatgcccttcagaaagccaaagaagtc
agccccatgtctgccccaaacatgcctgctatcgaaagagacaggcggaggagacaccac
atgtcgatgtgggagccacgcagcagccacctgcgggagcgtcgccggcggcaccacatg
tcggtgtgggagcagcggacgagccagctgcgccggcacatgcagatgtccagccaggag
gccatcaacaaggacgagccgcccctcatcaatccccacgccagcatcttccgcaggaag
agacccggggagggtgtcaccctggagaaatgcgctgaggagcagggcaagggcgagcgc
gagggacccgagcagccagtcccaggggcgaaccccggcggtggggaggacaggacatcg
ccacgggccaagcgagacatgtggcagcagaagtcttgccacgggaactgtgagccagga
gaacaggacggggcaggaggcagcatcgaggacagggcgaggatgaggcagagccagcgg
cgcagccggcaccgcagagcccgcatggaggggaaggacacggctggcatcttggggagc
cgctcggccagccaggagatggggctggaggaggccagcaccgccgagggggcacaggac
ggggaccggcgtggggacatggctgcagcagaagcgctgattccaggggagccagaggcg
agcggggagtccatcaggacaaacggggtccctgctggcgatgccgatctgcttgggacc
gccaagaaggggagccccccacacgccgcacccgagctctcccagggcaagacgggcacc
ctgacggagcaggactgcagcagcccggacacgagcgagcaggcgctgctggagcccagg
cgcagcgtgagccgcagcgagcccgacctctcctccatcacccccaacactgagaaggcc
accgagagcactgccatcatgatcgatgtccacgactccgctgtggtacagattagcaac
aagacagacggtgaagccagccccttaaaggaggccgagaccaaagaggatgaggaagaa
atggagaagaagaagcggaagaaggaaaagagcgagacgggcaaagccatggtgccgcac
agctccatgttcatcttcagcaccaccaacccggtgaggagggcctgccactacatcgtg
aacctgcgctacttcgagatgtgcatcctcctggtgatcgctgccagcagcatcgccctc
gccgccgaggatcccgtcctcaccaactccgaccgcaacaaagtgctgaggtatttcgac
tacgtcttcactggtgtcttcaccttcgagatggtgatcaagatgattgatcagggcttg
atcctgcaggatggctcctacttccgagacctgtggaacatcctggatttcatcgtggtg
gtgggagcgctggtggcttttgccttggcgaatgctttggggaccaacaaaggccgggat
atcaagactatcaagtctctccgtgtgctgcgggtcttgaggcccctgaaaaccatcaag
agactgcccaagctaaaggctgtttttgactgtgtcgtgacatctctcaagaacgtcttc
aacatcctcattgtctacaagctcttcatgttcatcttcgccgtcatcgccgtgcagctc
ttcaaggggaagttcttctactgcaccgacagctccaaggacacgcagaaggactgcata
gggaactacgtggaccacgagaagaacaagatggaggtgaaatgtcgggagtggaagcgg
cacgagtttcactatgacaatatcatctgggctctgctcaccctgttcaccgtgtccact
ggcgaagggtggccccaggtgctgcagcactcggtggatgtgacggaggaggaccgcggg
cccagccgcagcaaccgcatggagatgtccattttttatgtcgtctacttcgtggtcttc
cctttcttcttcgtcaacattttcgtggctctcatcatcatcacgttccaagagcaagga
gacaaaatgatggaggagtgcagcctggagaagaacgagagggcctgcattgactttgcc
atcagcgccaagcccctgacgcggtacatgccccagaacagacacaccttccagtaccgc
gtgtggcacttcgtggtgtccccgtccttcgagtacaccatcatggccatgattgcgctc
aacaccgtggtgctcatgatgaagtactattctgctccatacacctatgagctggccctc
aagtacctgaacattgccttcaccatggtgttctccttggagtgcgtcctcaagatcatc
gcttttggcttcctgaattatttccgggacacctggaacatctttgacttcatcacggtc
attggcagcattacggagatcatcctgacggacaccaagctggtgaacaccagcagcttc
aacatgagtttcctgaagcttttccgggctgctcggctcatcaagctgctccgccagggt
tacaccatccgcatcctgctctggacctttgtgcagtccttcaaggcactcccctatgtc
tgcctgctgattgccatgcttttcttcatctatgccatcattgggatgcaggtttttggc
aatatcaaactagatgaggaaagccacattaaccggcacaacaacttccgcagcttcctg
ggctccctcatgctcctcttcaggagtgccaccggagaggcgtggcaggagatcatgctg
tcctgcctggagggcaaaggctgcgagccggacacgacggccacgtccgggcagaacgag
aacgagcgctgcggcactgacctggcctatgtttactttgtgtccttcatcttcttctgc
tccttcctgatgctcaatctgtttgtggccgtcatcatggacaactttgaatacctgaca
cgggattcctccatcctgggccctcaccatctggatgagtttgtccggatctgggcagag
tatgaccgagcagcgtgtggccgaatccattacactgagatgtatgaaatgctgactctt
atgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcctataagagactg
gtgctgatgaacatgcccgtggccgaggacatgacagtccacttcacctccaccctcatg
gccctgatccgcacggccttggacatcaaaattgccaaaggtggtgcagattggcagcag
ttggactccgagcttcaaaaggagatcctgaccatttggcctcacctgtcccagaagatg
cttgacttgttggtacccatgccaaaaacctctgacctgactgttgggaaaatatatgca
gccatgatgatcatggattactacaagcagagcaaggcgaagaagcagcggcagcagctg
gaggagcagaaaaatgccccaatgttccagcgcatggagccgtcctctctgccccaggaa
atcatctccaacgccaaggctctgccgtacctccagcaggacaccctctcgggcctgagc
agccgaggtgggttctcctcgctaagcccgctctcgccacaggagatcttccagctggcg
tgcatggatccggcccaggagcagttccaggagcaccagtctctggagccagaggttagg
gagtttcaaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcaggac
cacgctgtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtggtg
acagacaccagctccatgcggagatcgttctccaccatccgggacaagcggcccaacagc
tcctggctggacgagttctccatggagcgcagcagcgacaacacctacaagtcccgccgg
cgcagctaccactcctcgctccagctgtccgcccggcgcctcaacgctgactcgggccat
cggtccgaggggcaccgctcgggcagggagcgaggccggtccaaagagcgcaagcacctg
ctgtcccctgacatctcccgctgcaactccgaggagaggagtccccaggcacaggaggag
tcgccagagcgtcggcgcgagtcccggtcacccagcgagggcaggtcacagacacccagc
aggcagggcatgggctccctgagcgaaagctccatcccctccatctcggacaccagcacg
ccccggcgaggccgccgccagctgccgcctgtgccccccaagccgcgtcccctcctgtcc
tacgcctccatgctgcgacacgctggggacacctctcctcccgccgacgagagcgagggt
ggctcaccactgctctcctccagcctggatcccagcacggccggcccggccgagtcttcc
agctccccggtggcggggaagcagagccggcagtccacgccgcagcgctacatctcggag
ccctacctggcgctgcacgacgactcgcacgcctcagactgcggtgaggaggagacgctc
accttcgaggcggccgtggccaccagcctgggccgctccaacaccatcggctcggcgcca
ccgctgcggcacagctggcagatgcccaacgggcactaccggcggcggcggcgaggagcg
gcgcaaggtgtgatgtgcggggccagcatcgacgtgctcagcgacaccgaggaagatgac
aagtgctag

DBGET integrated database retrieval system