Taeniopygia guttata (zebra finch): 100222058 Help Entry 100222058         CDS       T01082                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04010   MAPK signaling pathway tgu04012   ErbB signaling pathway tgu04068   FoxO signaling pathway tgu04137   Mitophagy - animal tgu04140   Autophagy - animal tgu04150   mTOR signaling pathway tgu04210   Apoptosis tgu04218   Cellular senescence tgu04370   VEGF signaling pathway tgu04371   Apelin signaling pathway tgu04540   Gap junction tgu04625   C-type lectin receptor signaling pathway tgu04810   Regulation of actin cytoskeleton tgu04910   Insulin signaling pathway tgu04912   GnRH signaling pathway tgu04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100222058 (NRAS)    04012 ErbB signaling pathway     100222058 (NRAS)    04370 VEGF signaling pathway     100222058 (NRAS)    04371 Apelin signaling pathway     100222058 (NRAS)    04068 FoxO signaling pathway     100222058 (NRAS)    04150 mTOR signaling pathway     100222058 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100222058 (NRAS)    04137 Mitophagy - animal     100222058 (NRAS)   09143 Cell growth and death    04210 Apoptosis     100222058 (NRAS)    04218 Cellular senescence     100222058 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     100222058 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100222058 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100222058 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100222058 (NRAS)    04912 GnRH signaling pathway     100222058 (NRAS)    04916 Melanogenesis     100222058 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tgu04131]     100222058 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgu04147]     100222058 (NRAS)    04031 GTP-binding proteins [BR:tgu04031]     100222058 (NRAS) Membrane trafficking [BR:tgu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100222058 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     100222058 (NRAS) Exosome [BR:tgu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100222058 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    100222058 (NRAS)   Exosomal proteins of breast cancer cells    100222058 (NRAS)   Exosomal proteins of colorectal cancer cells    100222058 (NRAS) GTP-binding proteins [BR:tgu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100222058 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  100222058 NCBI-ProteinID:  XP_002194371 Ensembl:  ENSTGUG00000000988 LinkDB All DBs Position 26:5989364..5997253 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtgatcgatggcgagacgtgcctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgc gtcttcgccatcaacaacagcaaatccttcgccgacatcaacctctacagagaacagatc aagagagtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgatctg cccacgagaacagtggacacaaaacaggcccaagaattggcaaaaagctacggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agggagatccggcagtaccggatgaagaagctcaacagcagcgaggatgggaaccagggc tgcatgggactgtcctgccttgtcatgtga

DBGET integrated database retrieval system