KEGG   Taeniopygia guttata (zebra finch): 100225906
Entry
100225906         CDS       T01082                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Ras_bdg_2 Mst1_SARAH PHD
Other DBs
NCBI-GeneID: 100225906
NCBI-ProteinID: XP_030138681
Ensembl: ENSTGUG00000004653
LinkDB
Position
12
AA seq 342 aa
MELIELRELQPEPRPGRGRLERANALRISPARRPGPGAHPDPRLTAAPGAGHRFEPRRRG
LHTWCDLCGDFVWGGGRKSLQCRHCSFTCHYRCRALVQLDCGGPPGAGDEDDGNEQVLEK
DTNVDEPSEWEKAELDQVQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPATKRGPSLQAGRPHPQGVKRRTSFYLPKGTVKHLHIFSHTRASEVIDALLRKFTVIDN
PRKFALFERSEKDEQVYLRKLGDDEQPLRLRLLAGPSEKVLSFILKENETGEVNWDAFTL
PELHNFLLILQREEEEHVRRLRHRYARCRQKMQEALATLTPG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggagctcatcgagctgcgggagctgcagccggagccgcggccgggccggggccgcctg
gaacgggccaacgcgctgcgcatcagcccggcccgccggcccggccccggggcgcacccc
gacccgcggctgacggcggcaccgggcgccgggcaccgcttcgagccgcggcgccgcggg
ctgcacacctggtgcgatctctgcggggacttcgtctggggcggcggcaggaagagcctc
cagtgccgccactgcagcttcacctgccactaccggtgccgggcgctggtgcagctggac
tgcggcggccccccaggtgctggtgacgaggacgatggcaatgagcaggtgctggagaag
gacaccaacgtggatgagcccagcgagtgggaaaaggcagagctggaccaggtgcaggtg
gaacagcggatcaaggagtacaacagccaaatcaacagcaacctcttcatgagcctgaac
aaggatggctcctacaccggcttcatcaaggtgcagctgaagctggttcgtcctgtctcg
gtgccggccaccaagcggggcccgtccctgcaggcggggcggccacacccccagggggtg
aagcgccgcacgtccttctacctgcccaaggggaccgtcaaacacctgcacatcttctca
cacacccgcgccagcgaggtcatcgatgccctcctccgcaagttcaccgtcatcgacaac
ccccgcaagttcgccctcttcgagaggtctgagaaggatgagcaagtgtatctgcggaag
ctgggtgacgacgagcagcccctgcggctgcggctgctggccggtcctagcgagaaggtg
ctgagcttcatcctgaaggagaacgagaccggagaggtgaactgggacgccttcacgctg
ccggagctgcacaacttcttgctgatcctgcagcgggaggaggaggagcacgtgcggcgg
ctgcggcaccgctacgcgcgctgccgccagaagatgcaggaagcgctggccacgctcacg
ccggggtga

DBGET integrated database retrieval system