KEGG   Taeniopygia guttata (zebra finch): 100226968Help
Entry
100226968         CDS       T01082                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00590  Arachidonic acid metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100226968 (PTGS1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100226968 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100226968
NCBI-ProteinID: XP_002188186
Ensembl: ENSTGUG00000006822
LinkDB All DBs
Position
17
AA seq 631 aa AA seqDB search
MTRVRVRFLPAVPPTRGPGLGDTDLWAAKDIQASLSLEKWECAAVPKSHGVCRATCARFT
SVPVNPCCYFPCQNQGVCVRVGLRGYECDCTRTGYYGVNCTSPELWTRLHNLLKPSPAFY
HFILTHFKWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGYISWEAYANVSYYT
RVLPPVPANCPTPMGTKGKLQLPDPQLLAERFLLRQKFEADPRGTNMMFAFFAQHFTHQF
FKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQVVDGEVYPPMVTEA
PVHMVYPSRVPQEQQLAMGQEVFGLLPGLCVYATLWLREHNRVCDLLKRDHPTWSDEQLF
QTARLILIGETIKIVIEDYVQHLSGYYLSLKFDPELLFGSQFQYRNRIAVEFNQLYHWHG
LMPDSFIIQGQEYSYKQFLYNTSMLMDYGVEALVESFSKQVAGRIGGGQTINANVLHVAV
GVIQESRQLRLQPFNEYRKRFGMKPYKSFQELTGEEEKAAELEELYGDIDALEFYPGLLL
EKPQPNGIFGESMVEIGAPFSLKGLFGNPICSPEYWKPSTFGGATGFEIVKTASLEKLVC
LNVKKCPYVAFQVPAAAEHGSPRAAGSSTEL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgtccgtgtcaggttcctgcccgcagtccctccgacacgtggccccgggctc
ggggacaccgacctttgggcagctaaggacatccaggccagcctgagcctggagaagtgg
gaatgtgcagctgtccccaagagccacggggtgtgcagagccacctgtgcccgtttcacc
tccgtgcctgtgaatccctgctgctatttcccctgccagaaccaaggggtgtgtgtgagg
gttggcctgagaggatacgagtgcgactgcacgcggaccggctactacggggtgaactgc
acctcccctgagctctggacacgtctccacaacctgctgaagcccagtcctgccttctac
cacttcatcttgacccacttcaagtggttttgggacattatcaacagcaccttcatcagg
gacacactcatgaggctcgtgctgacagttcgtgccaatctcatccccagcccccccact
ttcaactctgactacggctacatcagctgggaggcctatgccaacgtcagctattacacc
cgcgtcctcccgcccgtgccagccaactgccccacgcccatgggcaccaaagggaagctg
cagctccctgacccccagctcctggcggagaggttcctgctgcggcagaagtttgaggct
gatccccgaggcaccaacatgatgtttgccttcttcgcccagcatttcacccaccagttc
ttcaagacatctgggaagatgggacgtggcttcaccaaggcgctggggcacggggtggac
ctgggacatttgtacggggacaacctgcagcggcagcaccagctgcgactcttccgagat
gggaagctgaaattccaggtggtggatggagaggtgtacccgcccatggtcaccgaggct
ccggttcacatggtgtacccgtcgcgcgtgccccaggagcagcagctggcgatggggcag
gaggtgttcgggctgctgccggggctctgcgtgtacgccacgctctggctgcgcgagcac
aaccgcgtctgcgacctgctcaagcgggaccaccccacctggagcgacgagcagctcttc
cagaccgcgcggctcatcctcatcggggagaccatcaagatcgttattgaggactatgtc
cagcacctcagtgggtactacctgagcctcaagttcgaccccgagctgttgtttgggtca
cagttccagtaccggaatcgcatcgcggtggagttcaaccagctctatcactggcacggg
ctgatgcccgactccttcatcatccagggacaagagtacagctacaagcagttcctctac
aacacctccatgctcatggactatggcgtggaggcactggtggagtccttttccaagcag
gtggcaggaaggatcggtgggggacagaccatcaatgccaatgtcctgcacgtggctgtt
ggggtcatccaggagtcccggcagctgaggctacagcccttcaacgagtaccggaaaagg
tttggcatgaagccctacaagtccttccaggagctgacaggagaggaagagaaagcagcg
gagctggaagagctgtatggagacattgatgctctggagttttacccaggcttgctgctc
gagaaaccccaacccaacggcatttttggggaaagcatggtggagatcggagctccattt
tccctgaaggggctttttggaaatcccatctgctccccagagtactggaaacccagtaca
tttggtggagctactggctttgagatcgtgaagacagcatccctcgagaagctcgtgtgc
ctcaacgtgaagaagtgcccgtatgtggcgttccaggtgccggccgctgcggaacacggc
agccctcgggctgctggatcatctacagagctctag

DBGET integrated database retrieval system