KEGG   Thalassococcus sp. S3: CFI11_19415
Entry
CFI11_19415       CDS       T05844                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00621  Dioxin degradation
thaa01100  Metabolic pathways
thaa01120  Microbial metabolism in diverse environments
thaa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CFI11_19415
Enzymes [BR:thaa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     CFI11_19415
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Ndr Peptidase_S15 FSH1 Peptidase_S9 Abhydrolase_4 Esterase
Other DBs
NCBI-ProteinID: QBF33367
UniProt: A0A4P6MQ51
LinkDB
Position
complement(3938037..3938870)
AA seq 277 aa
MLGQLHLNEGITEHFVDAGGIRTRYLEAGEGPVVVLIHGGGAGADSVGNWNAVIPRLSDA
YRVIAMDMVGFGETDKPGDDFVYSQEARNTHLTAFLDALSLDHVILIGNSMGGATALGVA
VAQPERVDKLVLMGSAGLVTEVHEGLAPVMNYDFTRHGMERLIRALTTEGFEISPDMVAY
RHEMSVRDDTRQAYGATMSWIKQQGGLYYEEDFVRQVRVPTLVVNGKQDKVVPLANAYRF
LELIEPSCGVILPHCGHWAMIEHPEQFAAVTRNFLES
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcttgggcagctacatctgaatgaaggcatcaccgaacatttcgtcgatgccggcggg
atccgcactcgctacctggaggcgggtgaaggtccggtggtggtcctgatccatggcggc
ggcgctggtgccgacagtgtgggcaattggaatgccgtgatcccgcgcctcagcgacgcg
tatcgtgttatcgcgatggatatggtcggtttcggagagactgataagccgggtgatgat
ttcgtctattctcaggaggcgcgcaatacacatctgaccgcattcctggatgcgctgtcg
ctagaccacgtgatcctcattggcaattcaatgggtggcgcaaccgcgttgggtgtcgct
gttgcacagccggagcgggtcgacaagctggtgctgatgggcagtgcgggtcttgtgacc
gaggtgcatgagggacttgcgccggtcatgaactacgacttcacccggcatggaatggag
cggttgatccgggcgctgaccacggaaggcttcgagatttcccccgacatggtggcgtat
cgccacgagatgtctgtccgggacgatacccgccaagcctacggcgctacgatgtcgtgg
atcaagcagcagggcggcctttactacgaagaagacttcgtgcggcaggtcagggtgccg
acactggtggtcaatggcaagcaggacaaggtggttccccttgccaatgcatatcgcttt
ctcgaactgatcgagccctcatgcggagttattttgccccattgcggtcactgggcgatg
atcgaacaccccgagcagtttgcggccgtgacccgtaactttttggagagctga

DBGET integrated database retrieval system