KEGG   Thalassococcus sp. S3: CFI11_19420
Entry
CFI11_19420       CDS       T05844                                 

Definition
(GenBank) carbazole dioxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00621  Dioxin degradation
thaa01100  Metabolic pathways
thaa01120  Microbial metabolism in diverse environments
thaa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CFI11_19420
Enzymes [BR:thaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     CFI11_19420
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C Rieske_2
Other DBs
NCBI-ProteinID: QBF33368
UniProt: A0A4P6MIZ8
LinkDB
Position
complement(3938912..3940060)
AA seq 382 aa
MNDLVSPEVLEQVKGWVPYVEAKLGFRNHWYPLCLASEIVEQKPIARKLLGENILLNRID
GTVFCIKDRCLHRGVRFSADLQCHTKNTVTCWYHGWTYRWDTGKLVDILTNPQSVQIGRH
NIRAYPVQEAKGIIFVYMGDREPTPLEQDVPPGFLDEDRVIFGKHRMVNSNWRIGAENGF
DGGHVYIHRNSVLVEGNDIALPLGFAPGKGKENFRAEIGDEGPTGVWDLLGEHSVPVFAA
SIEGEEDIMRGHMGSKRVAHTISIWLPGVLRVDPWPDTNTTQYEWYVPVSETEHIYFQTL
GKVCETEAETKEWEVAFHEKWVPMALEGFNNDDLKARLETQPFYEDDRGWLNEILYEPDR
CIIEWRRVASKHNRGIQSREHL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaacgaccttgtttcacccgaagttctcgaacaggtcaagggttgggttccttatgtt
gaagctaaattaggtttccgcaatcactggtatcccctttgcttagcgagtgaaattgtc
gaacaaaagcctattgcgcgtaagcttcttggcgaaaacatcctattgaaccgcatcgac
ggtacggtcttttgtatcaaggatcgctgtctgcaccggggcgtgcgcttctcggccgac
ctgcagtgtcacaccaaaaacacggtgacatgttggtatcacggttggacgtatcgctgg
gatacgggcaagcttgtcgacatcctgacaaacccgcaaagcgttcaaatcggacggcac
aatatccgggcctatccggtgcaggaagccaaggggataatcttcgtctacatgggcgat
cgagagccgacaccgctcgaacaggacgtcccaccaggttttctggatgaggaccgggtg
attttcggcaagcaccgcatggtcaattcgaactggcgcatcggtgcggaaaacggcttt
gatggggggcacgtctacattcaccggaacagcgttctggtggaagggaatgacattgcc
ctgccgttgggtttcgcccccgggaaaggcaaggaaaacttccgcgctgaaatcggtgac
gagggaccgaccggcgtttgggatctgcttggagaacactccgttcccgttttcgcagcc
tccatcgagggcgaagaggacattatgcggggtcatatgggctcgaaacgggtggcccat
acgatctccatctggttgccgggtgtgctgcgggtcgatccttggccagacaccaacacg
acgcaatacgaatggtatgtgcctgtcagtgagacggaacacatctacttccagaccctt
ggcaaggtttgcgaaaccgaggccgagacgaaggagtgggaggttgccttccatgaaaag
tgggtgccgatggcgcttgaagggttcaacaacgatgacctgaaagcccggctcgaaacg
cagcctttctacgaggatgatcgcggctggctgaatgagattctctacgagccggatcgc
tgcatcatcgaatggcggcgcgtggccagcaagcacaaccgcggtatccaaagccgggag
catctgtga

DBGET integrated database retrieval system