KEGG   Thalassococcus sp. S3: CFI11_20520Help
Entry
CFI11_20520       CDS       T05844                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00071  Fatty acid degradation
thaa00280  Valine, leucine and isoleucine degradation
thaa00281  Geraniol degradation
thaa00310  Lysine degradation
thaa00360  Phenylalanine metabolism
thaa00362  Benzoate degradation
thaa00380  Tryptophan metabolism
thaa00410  beta-Alanine metabolism
thaa00627  Aminobenzoate degradation
thaa00640  Propanoate metabolism
thaa00650  Butanoate metabolism
thaa00903  Limonene and pinene degradation
thaa00930  Caprolactam degradation
thaa01100  Metabolic pathways
thaa01110  Biosynthesis of secondary metabolites
thaa01120  Microbial metabolism in diverse environments
thaa01130  Biosynthesis of antibiotics
thaa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CFI11_20520
   00650 Butanoate metabolism
    CFI11_20520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFI11_20520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFI11_20520
   00310 Lysine degradation
    CFI11_20520
   00360 Phenylalanine metabolism
    CFI11_20520
   00380 Tryptophan metabolism
    CFI11_20520
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFI11_20520
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFI11_20520
   00281 Geraniol degradation
    CFI11_20520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFI11_20520
   00627 Aminobenzoate degradation
    CFI11_20520
   00930 Caprolactam degradation
    CFI11_20520
Enzymes [BR:thaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFI11_20520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: QBF33578
UniProt: A0A4P6MJI3
LinkDB All DBs
Position
complement(4157524..4158384)
Genome map
AA seq 286 aa AA seqDB search
MSCVTYDVNNRVARILLNRPSVLNAIDDEMPAALAAAVARADADPDVHVMILAGAGSAFC
AGYDLKYYAEGNGSGDVTQPMPWDPIKDYRFMWTNTQHFMSLWRAMKPVICKVHGVAVAG
GSDIALCADLTIMAEDAQIGYMPARVWGCPTTAMWVYRLGAERAKRMLFTGDKISGREAA
DMGLVLKAVPADDLDDEVEALAARMASVPINQLAMQKMVINQAIEATGMMETQRLATLFD
GITRHSPEGLNFKTRAEDLGWKTAVRERDEGTFDWTENVPLPKRNR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtgtgacttatgacgtaaacaaccgtgttgcgcggattttgctcaacagaccc
agtgttttaaacgcaatcgacgatgagatgcccgcagcacttgctgcggcggtggcacgt
gcggacgcggatcccgacgtccatgtcatgattctcgccggagccggttctgcattttgc
gcgggctatgatctaaaatattatgccgaaggaaatgggtcaggtgatgtgacgcaaccc
atgccatgggacccgatcaaggattaccggttcatgtggaccaacacccaacacttcatg
tcgctgtggagagccatgaagccggtcatctgcaaggtgcacggggtcgcggttgccggt
ggatcggacatcgccctttgcgcggatctgacgatcatggccgaggatgcacagatcggt
tacatgccggcacgcgtctggggttgtccgacaacagccatgtgggtctaccggctgggg
gccgagcgggccaaacgcatgctctttaccggcgacaaaatcagcgggcgagaggcggcg
gatatgggccttgtgctcaaagcggttcccgctgatgacctggacgatgaggtcgaggcg
cttgctgcgcggatggccagcgttccgataaaccagcttgcgatgcagaagatggtgatc
aatcaggcgattgaggcaaccgggatgatggagacccagcgcctggccacgctttttgac
gggatcacccgccactcgcctgaaggcctgaacttcaagacccgcgcagaagatctgggg
tggaagaccgccgtccgggaacgggacgaggggaccttcgattggacggagaatgtcccg
ctgcccaaaagaaaccgctaa

DBGET integrated database retrieval system