KEGG   Thalassospira marina: CSC3H3_00340
Entry
CSC3H3_00340      CDS       T05224                                 

Gene name
ptsP
Definition
(GenBank) phosphoenolpyruvate--protein phosphotransferase
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
thac  Thalassospira marina
Pathway
thac02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:thac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CSC3H3_00340 (ptsP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thac02000]
    CSC3H3_00340 (ptsP)
Enzymes [BR:thac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     CSC3H3_00340 (ptsP)
Transporters [BR:thac02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    CSC3H3_00340 (ptsP)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers
Other DBs
NCBI-ProteinID: AUG54841
UniProt: A0A2N3KT17
LinkDB
Position
76361..78097
AA seq 578 aa
MIAGLGASGGIVIGRAFVLDRQYIHVIRQTIPADRIEQEVTTLHRGVDDSIEQLRRLKSQ
SGALEASASDELGFLLDAYIQMLTQSRLLRGAEDRIRQQKMNAVWAVSDVIDSIAQQFSG
IKDRYIAARAADIREVGLRLMRCLMGETDRALDNAPRGAILIAEELSPADMARLQPGNVG
AFVTAIGGAEGHTAIMARALGIPAVLGAADIIRGISGGDTVIVDGIRGEVILRPTDADLK
LYGKRREDWLAARTKLLGLRSLPSETKDKVQVDLHANIELPVEVTTVLQNGASGIGLLRS
EFMFMNKNYLPDEEEQYQELAGIVSQMNDLPVTIRTLDIGGEKLAVALQNEMGSGPNPAL
GLRGVRLSLRREDLLEAQLAAILRASLHGRVRVLVPMVVTVAEMVRVRQIYNRVADRLRA
NGHKIPKTLPPLGAMIEIPAAALSIDALARECEFFAIGTNDLTQYTLAIDRSDDQVAHSY
DPLHPAILRLIHEVSKASLRNNVPLSVCGEMAGDPRYTPLFLGMGLRNLSMSPGSLLPVK
QRVRRLDSRTSEYQTQQILDQWDPARIAVMLDDFNDLA
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgattgccggcctgggggcatctggcggcatcgtcattggccgggcctttgttctggac
cgtcaatatatccatgttatccgtcagaccattccggcggaccgcattgaacaggaagtc
accaccctgcatcgcggggttgatgacagcatcgaacagcttcgccgcctgaaatcgcag
tcaggcgcgctggaggcctctgcctccgacgagctgggcttcctgcttgatgcctatatc
cagatgctgacccagtcacgcctgctgcgcggtgccgaagaccgtattcgccagcagaaa
atgaatgcggtatgggcggtcagcgatgttattgacagcattgcccagcaatttagcggc
atcaaggaccgctatattgccgcgcgcgccgccgatatccgcgaagttggcctgcggctg
atgcgctgcctgatgggcgaaaccgaccgggcgctggataatgccccgcgcggcgccatc
ctgattgccgaagaactcagcccggctgatatggcgcgtttgcaacccggcaatgtcggt
gcctttgtgacggccattggcggggccgaagggcacacagccattatggcgcgtgcgctg
ggtatcccggctgtattgggggcggctgatatcatccggggtatttcgggtggtgatacc
gtcattgtcgatggcattcgcggcgaggtcattttacggcccaccgatgccgacctgaaa
ttatatggcaaacgccgcgaagactggcttgctgcacggaccaaacttttgggcctgcgc
agcctgccatcggaaaccaaggacaaggtgcaggtggacctgcacgccaatatcgaatta
cccgtcgaagtcacgaccgttttgcaaaacggggcttcgggtatcggccttttgcgcagc
gagttcatgttcatgaacaagaactacctgcccgatgaagaagaacaatatcaggaactg
gccggcatcgtcagccagatgaatgacctgccggtaacaatccgtacccttgatattggt
ggggaaaagctggctgttgccctgcaaaatgaaatgggaagcggcccgaaccctgccctt
ggtttgcgcggtgtacggctgtcgctgcgccgtgaggatttgctggaagcccaactggct
gccattttgcgtgcatccctgcatgggcgggtaagggtgctggtgcccatggtggtgact
gtggccgaaatggtgcgtgtgcgccagatatacaatcgcgtggcagatcgcctgcgggcc
aatggccacaaaattcccaaaaccctgccgccattgggtgccatgatcgaaattcccgct
gctgcacttagtattgatgcgctggcgagggaatgcgaattttttgccatcggcaccaac
gatttaacacaatataccctggccattgaccgcagtgatgaccaggttgcgcattcctat
gacccgttgcatcccgcgattttgcgcctgatccacgaggtttctaaggcatcgttgcgc
aataatgtcccgctaagtgtttgtggtgaaatggccggtgatccgcgctatacgccgcta
tttttgggaatggggctgcgcaatctgtcgatgtcgccgggcagcctgttgccagtcaag
cagcgggtacgccgcctggatagccgcacgtcggaatatcagacccagcagatcctggat
caatgggacccggcccgcattgccgtgatgctcgatgatttcaacgaccttgcctga

DBGET integrated database retrieval system