KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_14030Help
Entry
C6Y53_14030       CDS       T05357                                 

Definition
(GenBank) fumarylacetoacetate hydrolase family protein
Organism
thas  Rhodobacteraceae bacterium SH-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase DUF2437
Motif
Other DBs
NCBI-ProteinID: AVO38700
UniProt: A0A2S0MS44
LinkDB All DBs
Position
complement(2849450..2850379)
Genome map
AA seq 309 aa AA seqDB search
MKLVTFENAAGTQGIGILDGDRIAVLDGDANPAFASMLALIEAGEAGLDAARKARAGAGM
IDLATVSLRAPVPVPVQMRDCLTFEKHIRQCRSTMSKLDPNVPDLEPDEVPVAQVWYDQP
VYYKGNRFSVSGMDDEIVWPRGETRLDYELELGMITSRGGVDIAQADALDHVFGFTIFND
FSARDHQMREMAGGLGPAKGKDWKTANAMGPCLVTRDEIGDGSGLQMVARVNGEEWSRGN
SSTMHHSFARILEHVSRDEEIRAGEFFGSGTVGGGCGLELNRFLSPGDVVELAIEGIGIL
RNRIGARQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtgaccttcgaaaacgccgccggaacgcagggcatcggcatcctcgacggc
gaccggatcgccgtgctggacggcgacgcgaacccggccttcgcctccatgctcgcgctg
atcgaggcgggcgaggcggggctggatgccgcgcgcaaggcgcgcgccggtgccggcatg
atcgacctggccaccgtttccctccgcgcgccggtgccggtgccggtgcagatgcgggat
tgcctgaccttcgagaagcacatccgccagtgccggtccaccatgtcgaagctcgatccg
aacgtgccggacctggaaccggacgaggtgccggtcgcgcaggtctggtacgatcagccg
gtctattacaaaggcaaccgattctcggtctcgggcatggatgacgaaatcgtctggccg
cggggtgaaacgcggctcgattatgaactcgaactgggcatgatcacgtccaggggcggc
gtggacatcgctcaggcggatgcgctggaccatgtgttcggcttcaccatcttcaacgac
ttctcggcccgcgatcaccagatgcgggaaatggcgggcggtctcggccccgccaagggc
aaggactggaaaaccgcgaacgccatgggcccctgtcttgtcaccagggatgagatcggc
gacggatcgggcctgcagatggtggcccgcgtcaacggcgaggaatggagccggggcaat
tcctcgaccatgcaccattccttcgcccgcatcctcgaacatgtcagccgcgacgaggaa
atccgcgccggcgaattcttcggatcgggcaccgtcgggggcggctgcggattggagctg
aaccggttcctttcgcccggcgacgtagtcgaactggcaatcgagggcatcggcattctg
cgcaaccggatcggggcgcgacagcgataa

DBGET integrated database retrieval system