KEGG   Rhodobacteraceae bacterium SH-1: C6Y53_15620Help
Entry
C6Y53_15620       CDS       T05357                                 

Gene name
fsa
Definition
(GenBank) fructose-6-phosphate aldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
thas  Rhodobacteraceae bacterium SH-1
Pathway
thas00030  Pentose phosphate pathway
thas01100  Metabolic pathways
thas01110  Biosynthesis of secondary metabolites
thas01120  Microbial metabolism in diverse environments
thas01130  Biosynthesis of antibiotics
thas01200  Carbon metabolism
thas01230  Biosynthesis of amino acids
Module
thas_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:thas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C6Y53_15620 (fsa)
Enzymes [BR:thas01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     C6Y53_15620 (fsa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA ALAD
Motif
Other DBs
NCBI-ProteinID: AVO38996
UniProt: A0A2S0MT03
LinkDB All DBs
Position
complement(3196477..3197130)
Genome map
AA seq 217 aa AA seqDB search
MKFFVDTAEIDAIAELNDLGMVDGVTTNPSLILKSGRDILEVTREICDLVDGPVSAEVVA
TEAEAMIAEGRKLAQIADNIAVKVPLTWDGLKACKVLSGEGNMVNVTLCFSANQAILAAK
AGATFISPFIGRLDDINTDGMDLIADIRTIYDNYGFETQILAASIRTVNHITESARIGAD
VITAPPAVIKAMASHPLTDKGLATFLADWEKTGQKIL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttcgtcgacaccgccgaaatcgacgccattgccgagctgaacgacctgggc
atggtcgacggcgtgaccaccaacccgtcgctgatcctgaaatcgggacgcgacattctc
gaggtgacccgcgaaatctgcgatctcgtcgatggcccggtctcggccgaggtcgtcgcc
accgaagccgaggcgatgatcgccgaaggccgcaaactggcgcagatcgccgacaacatc
gcggtcaaggtgccgctgacctgggacgggctgaaggcctgcaaggtgctgtcgggcgag
ggcaacatggtcaacgtgaccctgtgtttctcggccaaccaagcgatcctggcggccaag
gcgggcgccacgttcatctcgcccttcatcggccggctggacgacatcaacaccgacggg
atggacctgatcgccgatatccgcacgatctatgacaattacggcttcgagacccagatc
ctcgccgcgtcgatccgcaccgtgaaccatatcaccgaaagcgcccgtatcggcgctgac
gtgatcaccgccccgcccgccgtcatcaaggccatggccagccacccgctgaccgacaag
gggttggccaccttcctggcggactgggaaaagaccggccagaagatcctgtaa

DBGET integrated database retrieval system