Thermococcus argininiproducens: K1720_08115 Help Entry K1720_08115       CDS       T08316                                  Name (GenBank) 4Fe-4S binding protein   KO K23976   L-aspartate semialdehyde sulfurtransferase ferredoxin Organism thei  Thermococcus argininiproducens Pathway thei00270   Cysteine and methionine metabolism thei01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:thei00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     K1720_08115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_18 Fer4_3 Fer4_17 Fer4_13 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  USG99477 UniProt:  A0A9E7M9K8 LinkDB All DBs Position complement(1521155..1521352) Genome browser AA seq 65 aa AA seqDB search MVEKIKIIVNEDKCYLCGGCAGVCPSLAIKVSSSKWEFFQDKCISCKICINACPVGALDF EPLEG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggtggagaagattaaaatcattgtcaatgaggataagtgctatctttgcggtggatgt gccggggtctgtccatcacttgcaataaaagtgagctcgtctaaatgggaattctttcag gacaaatgtatatcatgtaagatatgcataaatgcatgtccggttggcgctttggacttt gaaccgttggagggataa

DBGET integrated database retrieval system