KEGG   Thermogladius calderae: TCELL_0923Help
Entry
TCELL_0923        CDS       T02127                                 

Definition
(GenBank) HD superfamily metal-dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
thg  Thermogladius calderae
Pathway
thg00790  Folate biosynthesis
thg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCELL_0923
Enzymes [BR:thg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     TCELL_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2
Motif
Other DBs
NCBI-ProteinID: AFK51347
UniProt: I3TF09
LinkDB All DBs
Position
complement(862547..863260)
Genome map
AA seq 237 aa AA seqDB search
MAVSQLLDRLLEYAGSIGDPRIRQVVQDMLKDPVLTFTDARPQVTLHESPAAPRKHHFFT
GGLLLHTLGVVELAVRIRDYVETVYGLKADRDLVIAAAILHDLFKYYQYEKDEAEGGYKP
RGDWYVSHDYSLVAELAKRGAPDRLIRAVVEAHGLQPFTTLEGLIVHIADSADARLVDIL
QQVLVNNLKTLDKEGCNPIKVIDEKARRVGANRVFESLFEDRGKLIESFKQYCGGGS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgagccagctgctcgataggctactagagtacgccggaagtataggtgacccc
cgcatcaggcaagtagtacaggacatgctcaaggacccggtgctgacgttcactgacgcg
aggccgcaagtaaccctccacgaatccccagctgcgccgcgcaaacaccacttcttcacg
ggaggcctcctactccacacgcttggcgtcgtcgagctagccgtcaggatcagggactac
gtcgagaccgtttacggactaaaggcggacagagacctcgtgatagccgccgctatactc
cacgacctgttcaagtactaccagtacgagaaggacgaggccgagggcggctacaagccc
cgaggcgactggtatgtctcccacgactactctctcgtagccgagctcgctaagcgcggc
gcgcccgacaggcttatcagggctgtggtagaagcacacggcctccagcccttcactacg
ctagagggcctgatagtgcacatcgcggactccgcagacgcgaggttggttgacatacta
cagcaggtcctcgtaaacaacttgaagactctggataaagaggggtgtaaccctattaag
gttattgacgagaaggccaggagagtaggagctaaccgtgtattcgaaagcctattcgag
gatagggggaagctcatcgagtctttcaaacagtactgcggtggtggttcttga

DBGET integrated database retrieval system