KEGG   Thalassotalea sp. HSM 43: E2K93_08730Help
Entry
E2K93_08730       CDS       T05926                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tht  Thalassotalea sp. HSM 43
Brite
KEGG Orthology (KO) [BR:tht00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2K93_08730 (ahpF)
Enzymes [BR:tht01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E2K93_08730 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA DAO FAD_binding_2 Thi4 FAD_oxidored NAD_binding_8 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl K_oxygenase 3HCDH_N Glutaredoxin FAD_binding_3 ELFV_dehydrog Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: QBY04467
UniProt: A0A4P7JL26
LinkDB All DBs
Position
complement(2040822..2042381)
Genome map
AA seq 519 aa AA seqDB search
MLSPDILNTLKTYTANMKNPVTLVLQTGAHQKRDELHEFLSKLCSISDNLILQQADINLR
SPISFALQVDGKPNGIIFSGIPGGHEFNSLILAILQSSGSPIKLDDTLTGLLKNINEPLH
FEVFVSLSCHNCPDVVQSLNQFALINDNINSEMIDGGLYEQLIAERNIQGVPSVYLNGEL
FANGKIDTAQLIDKLLKRYPHIAKTSQTEQLPTQDVTVIGGGPAGVASAIYAARKGLKVT
MIADRIGGQVKDTVDIENLISVNKTTGTQLTNNMQQHMSDYDITLKEHVRVDNIDKGGDD
KLKTLHLSSGEIITSKTIIVATGAKWRELGVPGEKENVGSGVAYCPHCDGPFFKGKDVAV
VGGGNSGIEAALDLAGMVNKVTVFEFMDEFKADQVLLDKARANDKITLINNAETKQIIAT
DGKVSAIEYTDRSSNQTHQVELAGVFVQIGLLPNSQFLQNVVESTRFGEVIIDEKCHTTE
PGIFAAGDVTTVPYKQIVVAMGEGSKAALSAFDYLIKEF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttatctccagatattctcaacacattaaaaacttacactgccaacatgaaaaaccct
gtgacattggtattgcaaaccggtgcgcatcaaaaacgcgacgaattacatgagttttta
agcaagctttgttcgatttccgacaacttgattttacaacaggcggatatcaatttacgc
agtccaatttcatttgcactgcaagtcgatggcaagcctaatggcattattttttctggc
attcccggcggtcacgaatttaactcactaattttggcgattctgcagtcatcaggttca
ccaatcaagctagatgacaccttaaccggcttactcaaaaacattaatgaaccattgcat
tttgaagtgttcgtcagcctaagctgtcataactgtccggatgtagtgcaatctttgaat
caatttgcgctgattaatgacaacattaacagtgagatgattgatggtggtttatacgaa
caattaatcgctgaacgcaatattcaaggtgtgccaagcgtttaccttaacggcgagtta
tttgctaacggtaaaatcgataccgcacagcttatcgacaagctacttaaacgctatcca
cacattgcaaaaactagtcaaactgaacaactgccaacgcaagatgttaccgtcattggc
ggtggcccagcgggtgttgcctctgcgatttatgccgcccgcaaaggcttaaaggtaacc
atgattgccgatcgcattggcggtcaagtaaaagacacggtcgacatagaaaacctgatt
tcggtaaataaaaccacaggcactcaactgaccaataacatgcaacagcatatgagtgat
tatgacatcaccttaaaagaacatgtgcgcgtcgacaatatcgacaaaggtggcgacgat
aagttgaaaaccttgcacttgtcatccggcgaaatcattaccagtaaaaccattattgtt
gccacaggtgccaaatggcgtgaacttggcgtgccaggcgagaaagagaatgtgggttca
ggtgtggcttattgcccacactgtgatgggccttttttcaaaggcaaagacgtcgctgtt
gtcggtggtggtaactcaggtatcgaagccgcattagatttagctggtatggtaaataag
gtaacggtatttgagtttatggatgaatttaaggctgaccaagtgctgctcgataaagcc
agagcaaacgataaaatcacgttgatcaataatgccgaaaccaagcaaattattgccact
gatggcaaagtcagcgcgattgaatataccgatcgtagcagtaatcaaacccatcaagtt
gaactagccggtgtgttcgtacaaatcggtttgctgccaaacagccaatttctgcaaaac
gtggttgaaagcacccgttttggcgaagtgattattgatgaaaagtgtcacaccacagag
cctggcattttcgccgcgggtgacgtgacaacagtaccttacaagcaaattgttgttgcc
atgggcgaaggttctaaagctgcattatcggcctttgactacctaataaaagagttttaa

DBGET integrated database retrieval system