KEGG   Thermincola potens: TherJR_0025
Entry
TherJR_0025       CDS       T01226                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
tjr  Thermincola potens
Pathway
tjr00300  Lysine biosynthesis
tjr01100  Metabolic pathways
tjr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    TherJR_0025
Enzymes [BR:tjr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     TherJR_0025
SSDB
Motif
Pfam: AlaDh_PNT_C AdoHcyase_NAD Shikimate_DH Pyr_redox_2 2-Hacid_dh_C NAD_binding_7 3HCDH_N Pyr_redox NAD_binding_8 ThiF DUF43 ELFV_dehydrog FAD_binding_3 DAO Rossmann-like XdhC_C FAD_oxidored
Other DBs
NCBI-ProteinID: ADG80921
UniProt: D5X8E2
LinkDB
Position
30482..31309
AA seq 275 aa
MTRLKTEDICHIKASLEKYNRDLIAKTGATLGQIAAYAAETREEKVCRNFKVAVIPLTCG
RGIIEGFTQTVASITGFLGFNSFVTKNTDAGGVAEAVEKGAEILMMADDDKFVAINRVTG
RVSDNGEATGRGYAAALDLMTGGLRNRNVLILGAGPVGKGAALALARLGAKISVYDVEPG
CSNRLAEEVREKTGITVRIEEKLDRALLVNKIIYDATPTPSFIHKKHITPDTFIAAPGIP
LGVDGEALPEVAGRLLHDPLEIGVATMIYDVCRQA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacaaggctgaaaacagaagacatttgtcacattaaggcatcattggagaaatataac
agggacttaattgccaaaacgggtgccactttgggacagatagccgcctatgcggcagaa
accagagaagaaaaggtttgccgtaattttaaggtggccgtgataccccttacctgtggg
cggggaataatagaaggtttcacgcaaactgttgccagtataaccggttttttgggcttt
aactcttttgttactaaaaataccgatgccgggggagtggctgaagcggtggaaaaaggc
gccgaaatcttaatgatggccgatgacgacaagttcgtggcaattaaccgcgttacaggg
cgagtatctgataacggagaagccaccggcaggggatatgccgctgcccttgatttgatg
accggcggcctgagaaacagaaatgtcctcattttgggcgccggacccgttggaaaggga
gccgctttagctctggccaggctgggggccaaaatatcggtatatgatgttgaaccaggg
tgcagtaacagacttgcagaagaagtacgcgaaaagacaggtattacggtaagaatagaa
gagaaacttgatagggctttgctggtcaataaaattatttacgatgctactcccacacca
agtttcattcataaaaagcacataaccccggacacttttattgccgcacccggtataccg
ttgggggttgacggtgaagcgcttccggaggtagccggccgactgctccacgatccccta
gaaataggggtagctactatgatttatgacgtatgtagacaggcttaa

DBGET integrated database retrieval system