KEGG   Thermotoga maritima MSB8: TM0137Help
Entry
TM0137            CDS       T00022                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00260  Glycine, serine and threonine metabolism
tma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
tma01130  Biosynthesis of antibiotics
tma01230  Biosynthesis of amino acids
Module
tma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM0137 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM0137 (trpA)
Enzymes [BR:tma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM0137 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB
Motif
Other DBs
NCBI-GeneID: 896967
NCBI-ProteinID: NP_227952
UniProt: P50908 G4FH51
LinkDB All DBs
Position
complement(142818..143537)
Genome map
AA seq 239 aa AA seqDB search
MKGFIAYIPAGFPDLETTRKILIALNELGITGVEIGVPFSDPVADGPVIQLAHSVALRNG
VTIKKILEMLSEISVDYDLYLMSYLNPIVNYPEGKEKLLDELKKLGVKGLIIPDLPLREV
KNVDIAYPIVPFVAPNTKDEEIDLINSVQAPFVYYISRYGVTGEREDLPFADHIKRVKER
IKLPLFVGFGISRHEQVKKVWEIADGVIVGSALVRIMEENPKDEIPRKVVEKVKELLGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctttattgcatacatccccgctggatttcccgatcttgaaacaacaaggaaa
atactgatcgctctcaacgaactcggcatcacaggtgtggagataggagttccgttctcc
gatccggtcgcagacggtcctgttattcagcttgcccacagcgtggctttgagaaacggt
gtcactataaaaaagattctggagatgctgagtgaaatatctgttgattacgatctctac
ctgatgagttatctgaatccgatagtgaactatccagagggaaaagaaaaactcctcgat
gaattgaaaaaactcggtgtgaagggcttgatcatacctgacctgcccttgagggaggta
aagaacgtcgatatagcgtatcccatagttcccttcgttgcaccgaacaccaaagacgag
gaaatagatttgatcaattccgttcaggctccgttcgtctattacatatcccggtacggt
gtcacaggtgagagggaagaccttcctttcgcggatcacataaagagggtgaaagaaaga
ataaaacttcctctcttcgtgggttttggaatctccaggcacgaacaggtgaaaaaggtg
tgggagatcgccgacggtgtgatcgtcggaagtgctcttgtgagaataatggaagaaaat
ccgaaggatgagattcccaggaaggttgttgagaaagtaaaagaactcctcggaaaatga

DBGET integrated database retrieval system