KEGG   Thermosipho melanesiensis: Tmel_0512
Entry
Tmel_0512         CDS       T00550                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00521  Streptomycin biosynthesis
tme00523  Polyketide sugar unit biosynthesis
tme00525  Acarbose and validamycin biosynthesis
tme01100  Metabolic pathways
tme01110  Biosynthesis of secondary metabolites
Module
tme_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tmel_0512
   01055 Biosynthesis of vancomycin group antibiotics
    Tmel_0512
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tmel_0512
   00525 Acarbose and validamycin biosynthesis
    Tmel_0512
Enzymes [BR:tme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Tmel_0512
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind NifZ
Other DBs
NCBI-ProteinID: ABR30379
UniProt: A6LKC8
LinkDB
Position
546365..547384
AA seq 339 aa
MTLLVTGCAGFIGSNFVYYYLEKYKDRKIVGLDKLTYAGNLENLGKLTVEQRKRFKFIKG
DINNKELLEYIFEEYEIDGVINFAAESHVDRSIYDPQIFLKTNILGTQTLLDVAKKYWYR
DGKWKEGKKFLQVSTDEVYGSLGPTGYFTEKTPLDPHSPYSASKASADLIVKAYHDTYKM
PINITRCSNNYGPYQFPEKLIPLMIWNTLNHKELPVYGDGRQIRDWLYVKDHCRAIDMVY
EKGKVGEVYNIGGHNEKENIYIVKKIIEILRKKTGDKEINEGLIRHVKDRPGHDRRYGID
PTKIKEELGWEPEIMFDEGIELTIEWYLENIDWMKKVIK
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacattattagtcacaggttgtgcaggatttatagggagtaattttgtatattactac
cttgaaaaatacaaagatagaaaaatagtaggacttgacaaacttacttatgcaggaaat
cttgaaaaccttggaaaattaacagttgagcaaagaaaaagatttaagtttataaaaggc
gatataaacaacaaagaattgttggaatacatatttgaagaatatgaaatagatggagta
ataaattttgcagcagaaagtcatgttgataggtcaatatatgatccacagatattttta
aagacaaatatacttgggacacagacacttcttgatgtagcaaaaaaatattggtataga
gatggaaaatggaaagaaggaaagaaatttttacaagtatcaacagatgaagtatatggt
tcacttgggccaacaggttactttacagagaagacaccacttgacccgcacagtccatat
tcagcaagcaaagcatcagcagatttaattgtaaaagcataccatgatacatataaaatg
ccaataaacataacaagatgttcgaataactatgggccatatcaatttccagagaaattg
ataccattaatgatatggaacacgttaaatcacaaagaacttccagtatatggagatggg
agacaaataagagactggttgtatgtaaaagaccattgtagagcaatagacatggtatat
gagaaagggaaagttggagaagtatataacataggagggcataatgaaaaagaaaacata
tacatagtaaaaaagataatagagatattaaggaaaaaaacaggagataaagagataaac
gaaggattgataagacatgtcaaagacaggccagggcatgatagaaggtatggaatagat
ccaacaaagataaaagaggaacttggatgggaaccagaaataatgtttgatgaagggata
gagctgacaatagaatggtatttagaaaatatagactggatgaaaaaggttataaaatga

DBGET integrated database retrieval system