KEGG   Tremella mesenterica: TREMEDRAFT_72714Help
Entry
TREMEDRAFT_72714  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K10865  double-strand break repair protein MRE11
Organism
tms  Tremella mesenterica
Pathway
tms03440  Homologous recombination
tms03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    TREMEDRAFT_72714
   03450 Non-homologous end-joining
    TREMEDRAFT_72714
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tms03032]
    TREMEDRAFT_72714
   03400 DNA repair and recombination proteins [BR:tms03400]
    TREMEDRAFT_72714
DNA replication proteins [BR:tms03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     TREMEDRAFT_72714
DNA repair and recombination proteins [BR:tms03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     TREMEDRAFT_72714
    BRCA1-C complex
     TREMEDRAFT_72714
   NHEJ (non-homologous end-joining)
    MRX complex
     TREMEDRAFT_72714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 18498806
NCBI-ProteinID: XP_007002131
JGI: Treme1_72714
LinkDB All DBs
Position
Unknown
AA seq 706 aa AA seqDB search
MVGPSQRSRRADSADPEITPSIIQQDPDNCFRILLATDNHIGYAEKDPVRGQDAINTFRE
ILQIAKEADVDFILLAGDLFHENRPSRTCMHQTIALLREYTMGDKPISFELMSDPMEGST
PGFSFPAVNYEDPNLNISIPVFSIHGNHDDPQGTGPEGALCALDVLSVSGVLNYFGKLDL
TADEAAADPSDQGIKIRPVLIRKGNTHLAMYGVGNVKDARMHYELRSNRVKMFMPDGGGE
VRDDDWFNMLLIHQNRVKHGPQQSVPEGMFDDSINLVIWGHEHDCRIWPERVEGKDYYIS
QPGSSVATSLAPGEAIPKHVGILSIQGSQFQIAEIPLKTVRPFVIEEVVLTEAAANPRNK
INLEERDTITSFLRAQVERLIAKAREEWEELHSGDDEEMMLPLIRLKVETSEVKEMTNPV
RFGQDFVGRVANPRDILQYYRKKKIAERKPQNRPDAPDIEDDDEDWGPDDLAAMTTNDRL
SKLRMATLVRQYLQAQNLEVLVENGLEDAIMRFVDKDDRDAIKDFVVDTVKTVGRDMRTK
EVDEDDVEEHMVRAKEMYERSQSRVASQWETEHKGREDNSKSRKAKNRPKDSDEDSMAAE
DSRMEVDSEASFQQSSAVGRGRTTSSTGTKSRAKGKQPLFDQDDEEEEEEVVPVKRKVPA
STSKTKPPAKTTTKKTPAKTNTKQAQLTFGKKPTGKAKPIELSDDD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggtaggtccaagtcaacgttcccgaagggccgattccgccgacccggaaataacccct
tccatcatacaacaagaccccgacaactgcttccgtatcctactggcaacggataatcat
ataggatacgctgaaaaagatccagttagaggacaagacgctatcaatacttttcgtgaa
atcctccagattgccaaagaggcagatgtggatttcatcctcctagcaggtgacttattt
catgagaatcgaccaagtcgaacatgtatgcatcagaccatcgccttgcttcgggaatat
accatgggcgataaaccgatttcattcgaattaatgagtgatcctatggaaggtagtaca
ccgggtttctccttcccagcagtcaattacgaagatccaaatttgaatatttctatacct
gtcttttcgatacatgggaatcatgatgatccgcaaggtactggacctgaaggtgctcta
tgcgctttggatgtgctctcggtgtctggagtgcttaattactttggcaaactcgacctt
acggcagatgaagcggctgccgacccttccgaccaagggataaagatccgaccagtcctc
atacgcaagggaaacacacacctggcaatgtatggagttgggaatgtcaaagatgccaga
atgcactatgagcttcgaagtaatcgagtcaaaatgttcatgccggatggaggtggggaa
gtcagagatgacgattggttcaatatgttgctgatacaccaaaatcgcgtcaaacatggt
cctcaacaatcggtcccagagggcatgtttgatgattctatcaacctcgtgatatgggga
cacgaacatgattgtcgtatctggcctgagagggtagaagggaaagactactatatttct
cagccgggaagttcagtagcgaccagcttagctccaggagaagctatcccaaaacatgtt
ggcatattgtcaatacaaggcagtcaattccaaattgccgagataccactaaagacggtt
cgaccgtttgtgatcgaggaagtcgtcttgacagaagctgctgcgaatccaagaaacaaa
ataaatctggaggagcgagacacaataacgtccttcctacgtgcgcaggtggagagactc
atagccaaggctagggaagaatgggaagagctgcattccggtgatgatgaggagatgatg
ttgccactcatcagactgaaagtagagacgtccgaggtcaaggaaatgaccaatccagtc
cgattcggtcaagacttcgtaggccgtgttgccaaccctcgcgatattttgcaatactat
cgcaagaagaaaatagctgaaagaaagccccaaaaccggcccgatgccccagacatcgaa
gacgacgacgaagattggggacccgatgatctggccgctatgacgaccaacgatcgattg
tccaaattgaggatggcgacgcttgtcaggcaatacctacaagcgcagaatctggaggtg
ttggtggagaatgggctggaggacgccatcatgcgtttcgttgacaaagacgatagggat
gcgatcaaagattttgttgtggacactgtcaaaactgtgggaagggatatgcggacgaag
gaagtggatgaagatgacgtggaagagcatatggttcgggcgaaagagatgtatgagagg
tctcaaagccgtgtagcttctcaatgggagacggagcacaaaggtcgggaagataactcg
aaatcaaggaaagccaagaataggccgaaagactcagacgaggatagtatggctgctgaa
gatagcaggatggaagtcgactctgaagcttcgtttcagcaaagcagtgcggtaggtcgt
gggagaaccacgtcatctaccgggacgaaaagtcgggccaaaggaaaacaaccattattt
gaccaagatgacgaagaggaagaagaagaggtcgtacccgtcaaaagaaaggtcccagct
tccacatccaagaccaaacctcctgctaaaacgacgaccaagaaaactccagctaaaaca
aataccaaacaagcacaattgacgttcggaaagaagccgacgggaaaagcaaagccaatt
gaactgtccgatgatgattga

DBGET integrated database retrieval system