KEGG   Thermoanaerobacter mathranii: Tmath_0345Help
Entry
Tmath_0345        CDS       T01250                                 

Definition
(GenBank) hexulose-6-phosphate isomerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00040  Pentose and glucuronate interconversions
tmt00053  Ascorbate and aldarate metabolism
tmt01100  Metabolic pathways
tmt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tmath_0345
   00053 Ascorbate and aldarate metabolism
    Tmath_0345
Enzymes [BR:tmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     Tmath_0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 AP_endonuc_2_N
Motif
Other DBs
NCBI-ProteinID: ADH60123
UniProt: D7ARX9
LinkDB All DBs
Position
374352..375203
Genome map
AA seq 283 aa AA seqDB search
MENLIGIYEKALPKNLDWFCRLKLARELGFDFVEISIDESDERLERLYWPKEQKIRLVQD
IFASGVPIMTMCFSGHRRYPLGSNSKQIRDKAMELMHKAILFAKDTGIRVIQMAGYDVYY
EKSTPKTRRWFFEGLERSIELAEKYQVMLAMEVMDTPFINSITKYLEIEEMFNSPWFAVY
PDLGNLSAWNNDVVKEIEKGFHKIVAVHVKDTLAVTDTCKGKFRDVPFGSGCVDFVTAFS
ILKKLGYKGPFVIEMWSEKSQDPVAEVISAKEWVIARLKEGGF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatctaataggtatttatgagaaagcattgcctaaaaatttagactggttctgc
cgcctgaaattggctcgagagctaggttttgattttgtagaaatttctatcgacgaaagt
gatgaacgcttggaaagactctactggccaaaggagcaaaaaattcggctagttcaggat
attttcgctagtggtgtgcctataatgactatgtgctttagtggtcaccgccgatatcct
ctggggagtaattcaaaacaaataagagacaaagcgatggaattaatgcataaagctatt
ttatttgcaaaagatacgggcattagagtgattcaaatggctggatacgacgtttattat
gaaaaatcaaccccaaaaacgcgacgatggttttttgaaggattggagcgttctatagaa
ttggcggaaaagtatcaagttatgctggcaatggaggtcatggatactccttttataaat
tcgattactaaatatctcgagattgaagaaatgtttaactcaccatggtttgcggtatac
cccgatctgggaaacttatcggcgtggaataatgatgtagtaaaagagatcgaaaagggt
tttcacaaaatagttgctgtacacgtaaaagacactttagcagttactgatacttgtaag
ggaaagtttagagatgttccctttggatcgggatgtgtagatttcgtgaccgcttttagc
atattgaaaaaacttggttacaaagggccttttgtaattgaaatgtggtccgagaaatcc
caggatcctgttgcagaagtgatttcagcaaaggagtgggttatagctcggttaaaagag
gggggattttga

DBGET integrated database retrieval system