KEGG   Trichechus manatus latirostris (Florida manatee): 101344099
Entry
101344099         CDS       T05135                                 

Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04114  Oocyte meiosis
tmu04115  p53 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05161  Hepatitis B
tmu05162  Measles
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05215  Prostate cancer
tmu05222  Small cell lung cancer
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101344099
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101344099
   04114 Oocyte meiosis
    101344099
   04115 p53 signaling pathway
    101344099
   04218 Cellular senescence
    101344099
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101344099
   05206 MicroRNAs in cancer
    101344099
   05203 Viral carcinogenesis
    101344099
  09162 Cancer: specific types
   05226 Gastric cancer
    101344099
   05215 Prostate cancer
    101344099
   05222 Small cell lung cancer
    101344099
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101344099
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101344099
   05161 Hepatitis B
    101344099
   05162 Measles
    101344099
   05169 Epstein-Barr virus infection
    101344099
   05165 Human papillomavirus infection
    101344099
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tmu03032]
    101344099
   03036 Chromosome and associated proteins [BR:tmu03036]
    101344099
DNA replication proteins [BR:tmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101344099
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101344099
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101344099
NCBI-ProteinID: XP_023582729
UniProt: A0A2Y9QTQ8
LinkDB
Position
Unknown
AA seq 395 aa
MKEEGSTDFSSRSRKRKANVAVFLQDPDEEIAKIERTVRNQCGSQTWDSGAACENPCSLI
PTPDKEEGELAYPHAACEPPSFAPSRASPLPVLNWANREEVWKIMLNKEKTYLRDKHFMQ
RHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQQNVVKTLLQLIGISS
LFIAAKLEEIYPPKLHQFAYVTDGACTGDDILNMELGIMKALKWRLSPLTVVSWLNVYMQ
VAYLKDFYEVLLPQYPQQIFIQIAELLDLCVLDAGCLEFSYGVLAASALYHFSSSELMQK
VSGYQWCDIERCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNIQTHINSLDLLDKAQA
KKAIMSEQNRVSPLPTGVLTPPQSGKKQGSEQERA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaaagaggaaggcagcaccgatttctcttcgcgctccaggaaaaggaaagccaatgtg
gccgtgtttctgcaggatccagatgaagaaattgccaaaattgagaggactgtgagaaac
cagtgtggcagtcagacttgggacagcggtgcagcctgtgaaaacccctgctccctgatt
cccacccctgacaaagaggagggtgagctggcatacccacatgctgcctgtgaacctccg
agtttcgcaccgtctagagcctcaccgctgcctgttctgaactgggcgaatagggaggag
gtgtggaagatcatgctgaacaaagaaaagacgtacctgagggataagcacttcatgcag
cggcaccctcttctgcagccgaagatgcgagcaattctcctggattggttaatggaggtg
tgtgaagtatataaacttcacagggagacattttacctggcacaagatttctttgatcgg
tatatggcaacccaacaaaatgttgtaaaaacgcttctacagcttattgggatttcatct
ttatttattgctgccaaacttgaggaaatctaccctcccaagctgcaccagtttgcatac
gttacagacggggcctgtaccggagatgacattctcaacatggagttaggcattatgaag
gccctaaagtggcgtttaagtcccctgacagttgtgtcctggctgaatgtgtacatgcaa
gttgcatacctaaaggacttttacgaagtgctgttgccccagtatccccagcaaatcttc
atacagattgcagagcttttagatctctgtgtcctggacgctggctgcttagaattttct
tacggcgtgctcgctgcttctgccttgtaccatttctcgtcgtctgaactgatgcaaaag
gtttcagggtaccagtggtgtgacatagagaggtgtgtcaagtggatggttccatttgcc
atggtcataagggagacaggaagttcgaaactgaagcacttcaggggggttcctgctgaa
gatgcacacaacatacagacccatataaacagcttggatttgctggacaaagcccaagcc
aagaaagccataatgtctgaacagaacagagtctctcctctccccaccggggtcctcacg
cccccccagagtgggaagaagcagggcagcgagcaggaaagagcgtga

KEGG   Trichechus manatus latirostris (Florida manatee): 101361662
Entry
101361662         CDS       T05135                                 

Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04110  Cell cycle
tmu04114  Oocyte meiosis
tmu04115  p53 signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04218  Cellular senescence
tmu04934  Cushing syndrome
tmu05161  Hepatitis B
tmu05162  Measles
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05200  Pathways in cancer
tmu05203  Viral carcinogenesis
tmu05206  MicroRNAs in cancer
tmu05215  Prostate cancer
tmu05222  Small cell lung cancer
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101361662
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101361662
   04114 Oocyte meiosis
    101361662
   04115 p53 signaling pathway
    101361662
   04218 Cellular senescence
    101361662
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101361662
   05206 MicroRNAs in cancer
    101361662
   05203 Viral carcinogenesis
    101361662
  09162 Cancer: specific types
   05226 Gastric cancer
    101361662
   05215 Prostate cancer
    101361662
   05222 Small cell lung cancer
    101361662
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101361662
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101361662
   05161 Hepatitis B
    101361662
   05162 Measles
    101361662
   05169 Epstein-Barr virus infection
    101361662
   05165 Human papillomavirus infection
    101361662
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tmu03032]
    101361662
   03036 Chromosome and associated proteins [BR:tmu03036]
    101361662
DNA replication proteins [BR:tmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101361662
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101361662
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101361662
NCBI-ProteinID: XP_004370819
UniProt: A0A2Y9DB69
LinkDB
Position
Unknown
AA seq 406 aa
MSRRSSRLQAKQQPQPGQTDSSQEAQVIQAKKRKTTQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCVIIETPHKEIVTSDFSRFTNYRFKNLFINPSPLPDLSWGCSNEVWQNMLKK
ETRYTRYVHDKHFEVLHSDLEPQMRSILLDWILEVCEVYTLHRETFYLAQDFFDRFMLTQ
KDVNKNMLQLIGITSLFIASKLEEIYAPKLHEFAYVTDGACSEEDILKMELLILKALKWE
LCPVTIISWLNLFLQVDALKDAPKVLLPQYSQEKFIQVAQLLDLCILAIDSLEFQYRILA
AAALCHFTSTEVVKKASGLEWDDISECVDWMVPFVNVIKGTSPVKLKAFKKIPVEDRHNI
QTHSNYLVMLDEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPGKH
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcagcagccccaacccggccagacagat
tcctctcaagaagcccaggtaatccaggccaagaagagaaaaacaacccaggatgtcaaa
aaaagaaaagaggaggtcactaagaaacatcagtacgagattaggaattgttggccacct
gtattatctggggggatcagtccttgtgttatcattgaaacaccccacaaagaaatagta
acaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaatgaagtttggcaaaatatgttgaaaaaa
gagaccagatataccagatatgttcatgacaagcattttgaagttctccattctgacttg
gaaccacagatgaggtcaatacttctagactggattttagaggtatgtgaagtatacaca
cttcacagggaaacattttatcttgcacaagacttttttgatagatttatgttgacacaa
aaggatgtaaataaaaatatgcttcagctcattggaattacttctttattcattgcttcc
aaacttgaggaaatctacgctcctaagctccacgagtttgcttatgtcactgatggtgct
tgcagtgaagaggatatcttaaagatggaactccttatattaaaggctttaaaatgggaa
ctttgtcctgtaacaatcatctcctggctaaatctctttctccaagttgatgctcttaaa
gatgctcctaaagttcttctacctcagtattctcaggaaaagttcatccaagtagctcag
cttttagatctgtgtattctagccatcgattcattagagttccagtacagaatattggct
gctgctgccttgtgccattttacctctactgaagtggttaagaaagcctcaggtttggaa
tgggatgacatttctgaatgtgtagactggatggtgccttttgtcaatgtaataaaaggt
actagtccagtgaagctgaaggcttttaagaagattcctgtggaagacagacacaatatt
cagacacattcaaattatctagttatgctggatgaagtaaattatataaacaccttcaga
aaagggggacagttgtcaccagtgtgcaatggaggcatcatgacaccaccgaagagcacc
gaaaaaccaggaaaacactaa

DBGET integrated database retrieval system