KEGG   Trichechus manatus latirostris (Florida manatee): 101344523Help
Entry
101344523         CDS       T05135                                 

Definition
(RefSeq) UMP-CMP kinase
  KO
K13800  UMP-CMP kinase [EC:2.7.4.14]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00240  Pyrimidine metabolism
tmu00983  Drug metabolism - other enzymes
tmu01100  Metabolic pathways
Module
tmu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    101344523
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101344523
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.14  UMP/CMP kinase
     101344523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_18 Thymidylate_kin Zeta_toxin AAA_33 PAS_9 AAA_19
Motif
Other DBs
NCBI-GeneID: 101344523
NCBI-ProteinID: XP_004371826
UniProt: A0A2Y9DCH8
LinkDB All DBs
Position
Unknown
AA seq 228 aa AA seqDB search
MLSRYRRQLLHVLSLSFPLLTRRPLLLCPHHLMKPLVVFVLGGPGAGKGTQCTRIVEKYG
YTHLSAGELLRDERKNPDSQYGELIEKYIKDGKIVPVEITISLLKREMDQTMAANAQKNK
FLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRTDDNRESL
EKRIQTYLQSTKPIIDLYEEMGKVRKIDASKSVDEVFDEVVKIFDKEG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgttaccgccgccagctgctgcacgtcctgagccttagcttcccgctgctg
actcgccggccgcttctcctctgccctcaccacctcatgaagccgttggtcgtgttcgtc
ctcggggggccgggcgccggcaagggaacccagtgcacccgcatcgtcgagaaatatggc
tacacacacctttctgcaggagaacttcttcgtgatgaaagaaagaacccagattcacag
tatggtgaactcattgaaaagtacattaaagatggaaagattgtgccagttgagataacg
atcagcttgttaaagagggaaatggatcagacaatggctgccaatgcccagaagaataaa
ttcttaattgatgggtttccaagaaatcaagacaaccttcaaggttggaacaagaccatg
gatgggaaggcagatgtatcttttgttctgttttttgactgtaataatgagatctgtatc
gaacgatgtcttgagaggggaaagagtagtggtaggactgatgacaacagagaaagcttg
gaaaagagaattcagacctatcttcagtcaacaaagccaattattgacttatatgaggaa
atggggaaagtcaggaaaatagatgcttctaaatctgttgatgaagtttttgatgaagtt
gtgaaaatttttgacaaagaaggctaa

DBGET integrated database retrieval system