KEGG   Trichechus manatus latirostris (Florida manatee): 101350197
Entry
101350197         CDS       T05135                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04728  Dopaminergic synapse
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04922  Glucagon signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101350197
   04012 ErbB signaling pathway
    101350197
   04014 Ras signaling pathway
    101350197
   04015 Rap1 signaling pathway
    101350197
   04370 VEGF signaling pathway
    101350197
   04371 Apelin signaling pathway
    101350197
   04630 JAK-STAT signaling pathway
    101350197
   04668 TNF signaling pathway
    101350197
   04066 HIF-1 signaling pathway
    101350197
   04068 FoxO signaling pathway
    101350197
   04072 Phospholipase D signaling pathway
    101350197
   04071 Sphingolipid signaling pathway
    101350197
   04024 cAMP signaling pathway
    101350197
   04022 cGMP-PKG signaling pathway
    101350197
   04151 PI3K-Akt signaling pathway
    101350197
   04152 AMPK signaling pathway
    101350197
   04150 mTOR signaling pathway
    101350197
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101350197
  09143 Cell growth and death
   04210 Apoptosis
    101350197
   04218 Cellular senescence
    101350197
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101350197
   04550 Signaling pathways regulating pluripotency of stem cells
    101350197
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101350197
   04620 Toll-like receptor signaling pathway
    101350197
   04625 C-type lectin receptor signaling pathway
    101350197
   04660 T cell receptor signaling pathway
    101350197
   04662 B cell receptor signaling pathway
    101350197
   04664 Fc epsilon RI signaling pathway
    101350197
   04666 Fc gamma R-mediated phagocytosis
    101350197
   04062 Chemokine signaling pathway
    101350197
  09152 Endocrine system
   04910 Insulin signaling pathway
    101350197
   04922 Glucagon signaling pathway
    101350197
   04923 Regulation of lipolysis in adipocytes
    101350197
   04920 Adipocytokine signaling pathway
    101350197
   04929 GnRH secretion
    101350197
   04915 Estrogen signaling pathway
    101350197
   04914 Progesterone-mediated oocyte maturation
    101350197
   04917 Prolactin signaling pathway
    101350197
   04926 Relaxin signaling pathway
    101350197
   04935 Growth hormone synthesis, secretion and action
    101350197
   04919 Thyroid hormone signaling pathway
    101350197
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101350197
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101350197
  09156 Nervous system
   04725 Cholinergic synapse
    101350197
   04728 Dopaminergic synapse
    101350197
   04722 Neurotrophin signaling pathway
    101350197
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101350197
  09149 Aging
   04211 Longevity regulating pathway
    101350197
   04213 Longevity regulating pathway - multiple species
    101350197
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101350197
   05205 Proteoglycans in cancer
    101350197
   05230 Central carbon metabolism in cancer
    101350197
   05231 Choline metabolism in cancer
    101350197
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101350197
  09162 Cancer: specific types
   05210 Colorectal cancer
    101350197
   05212 Pancreatic cancer
    101350197
   05225 Hepatocellular carcinoma
    101350197
   05226 Gastric cancer
    101350197
   05214 Glioma
    101350197
   05221 Acute myeloid leukemia
    101350197
   05220 Chronic myeloid leukemia
    101350197
   05218 Melanoma
    101350197
   05211 Renal cell carcinoma
    101350197
   05215 Prostate cancer
    101350197
   05213 Endometrial cancer
    101350197
   05224 Breast cancer
    101350197
   05222 Small cell lung cancer
    101350197
   05223 Non-small cell lung cancer
    101350197
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101350197
   05017 Spinocerebellar ataxia
    101350197
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101350197
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101350197
   04931 Insulin resistance
    101350197
   04933 AGE-RAGE signaling pathway in diabetic complications
    101350197
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101350197
   05135 Yersinia infection
    101350197
   05152 Tuberculosis
    101350197
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101350197
   05170 Human immunodeficiency virus 1 infection
    101350197
   05161 Hepatitis B
    101350197
   05160 Hepatitis C
    101350197
   05164 Influenza A
    101350197
   05162 Measles
    101350197
   05168 Herpes simplex virus 1 infection
    101350197
   05163 Human cytomegalovirus infection
    101350197
   05167 Kaposi sarcoma-associated herpesvirus infection
    101350197
   05169 Epstein-Barr virus infection
    101350197
   05165 Human papillomavirus infection
    101350197
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101350197
   05142 Chagas disease
    101350197
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101350197
   01524 Platinum drug resistance
    101350197
   01522 Endocrine resistance
    101350197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101350197
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101350197
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101350197
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 101350197
NCBI-ProteinID: XP_023586662
UniProt: A0A2Y9QX25
LinkDB
Position
Unknown
AA seq 393 aa
MGNFPRFHREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMN
DFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHP
FLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGK
IVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRA
VDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPN
KRLGGGPDDAKEIMRHSFFSGINWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITI
TPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgggaaattttcctcgttttcatagggaagaatggacagaagctatccaggctgtagca
gacagactgcagaggcaagaagaggagagaatgaattgtagtccaacttcacaaattgat
aatataggggaggaagagatggatgcttctacaacacatcataaaagaaagacaatgaat
gattttgactatttgaaactactaggtaaaggcacttttgggaaagttattttggttcga
gagaaggcaagtgggaaatattatgctatgaagattctgaagaaagaagttattattgca
aaggatgaagtggcacacactctaactgaaagcagagtattaaagaatactagacatccc
tttttaacatccttgaaatactccttccagacaaaagaccgtttgtgttttgtgatggag
tatgttaatgggggagagctgtttttccatttgtcgagagaacgggtgttctctgaggac
cgcacacgtttctatggtgcagaaattgtctccgctctggactatctacattccggaaag
attgtgtaccgtgatctcaagttggagaatttgatgctggataaagatggccacataaaa
attacagattttggactttgcaaggaaggaatcacagatgcagccaccatgaagacattc
tgtggtacaccagaatatctggcaccagaggtgttagaagataatgactacggtcgagca
gtggactggtggggcctaggtgttgtcatgtatgaaatgatgtgtgggaggttacccttc
tacaaccaggaccatgagaaactttttgaactaatactaatggaagatattaaatttcct
cgaacactctcttcagacgcaaaatcattgctttcagggctcttaataaaggatccaaat
aaacgccttggtggaggaccagatgatgcaaaagaaattatgagacacagtttcttttct
ggaataaactggcaagatgtgtatgataaaaagcttgtacctccttttaagcctcaagta
acatctgagacagataccagatattttgatgaagaatttacagctcagacaattacaata
acaccacctgaaaaatatgatgaggatggtatggactgcatggacaatgagaggcggccg
catttccctcagttttcctactctgcaagtggacgagaataa

KEGG   Trichechus manatus latirostris (Florida manatee): 101356099
Entry
101356099         CDS       T05135                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04728  Dopaminergic synapse
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04922  Glucagon signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101356099
   04012 ErbB signaling pathway
    101356099
   04014 Ras signaling pathway
    101356099
   04015 Rap1 signaling pathway
    101356099
   04370 VEGF signaling pathway
    101356099
   04371 Apelin signaling pathway
    101356099
   04630 JAK-STAT signaling pathway
    101356099
   04668 TNF signaling pathway
    101356099
   04066 HIF-1 signaling pathway
    101356099
   04068 FoxO signaling pathway
    101356099
   04072 Phospholipase D signaling pathway
    101356099
   04071 Sphingolipid signaling pathway
    101356099
   04024 cAMP signaling pathway
    101356099
   04022 cGMP-PKG signaling pathway
    101356099
   04151 PI3K-Akt signaling pathway
    101356099
   04152 AMPK signaling pathway
    101356099
   04150 mTOR signaling pathway
    101356099
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101356099
  09143 Cell growth and death
   04210 Apoptosis
    101356099
   04218 Cellular senescence
    101356099
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101356099
   04550 Signaling pathways regulating pluripotency of stem cells
    101356099
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101356099
   04620 Toll-like receptor signaling pathway
    101356099
   04625 C-type lectin receptor signaling pathway
    101356099
   04660 T cell receptor signaling pathway
    101356099
   04662 B cell receptor signaling pathway
    101356099
   04664 Fc epsilon RI signaling pathway
    101356099
   04666 Fc gamma R-mediated phagocytosis
    101356099
   04062 Chemokine signaling pathway
    101356099
  09152 Endocrine system
   04910 Insulin signaling pathway
    101356099
   04922 Glucagon signaling pathway
    101356099
   04923 Regulation of lipolysis in adipocytes
    101356099
   04920 Adipocytokine signaling pathway
    101356099
   04929 GnRH secretion
    101356099
   04915 Estrogen signaling pathway
    101356099
   04914 Progesterone-mediated oocyte maturation
    101356099
   04917 Prolactin signaling pathway
    101356099
   04926 Relaxin signaling pathway
    101356099
   04935 Growth hormone synthesis, secretion and action
    101356099
   04919 Thyroid hormone signaling pathway
    101356099
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101356099
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101356099
  09156 Nervous system
   04725 Cholinergic synapse
    101356099
   04728 Dopaminergic synapse
    101356099
   04722 Neurotrophin signaling pathway
    101356099
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101356099
  09149 Aging
   04211 Longevity regulating pathway
    101356099
   04213 Longevity regulating pathway - multiple species
    101356099
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101356099
   05205 Proteoglycans in cancer
    101356099
   05230 Central carbon metabolism in cancer
    101356099
   05231 Choline metabolism in cancer
    101356099
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101356099
  09162 Cancer: specific types
   05210 Colorectal cancer
    101356099
   05212 Pancreatic cancer
    101356099
   05225 Hepatocellular carcinoma
    101356099
   05226 Gastric cancer
    101356099
   05214 Glioma
    101356099
   05221 Acute myeloid leukemia
    101356099
   05220 Chronic myeloid leukemia
    101356099
   05218 Melanoma
    101356099
   05211 Renal cell carcinoma
    101356099
   05215 Prostate cancer
    101356099
   05213 Endometrial cancer
    101356099
   05224 Breast cancer
    101356099
   05222 Small cell lung cancer
    101356099
   05223 Non-small cell lung cancer
    101356099
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101356099
   05017 Spinocerebellar ataxia
    101356099
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101356099
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101356099
   04931 Insulin resistance
    101356099
   04933 AGE-RAGE signaling pathway in diabetic complications
    101356099
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101356099
   05135 Yersinia infection
    101356099
   05152 Tuberculosis
    101356099
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101356099
   05170 Human immunodeficiency virus 1 infection
    101356099
   05161 Hepatitis B
    101356099
   05160 Hepatitis C
    101356099
   05164 Influenza A
    101356099
   05162 Measles
    101356099
   05168 Herpes simplex virus 1 infection
    101356099
   05163 Human cytomegalovirus infection
    101356099
   05167 Kaposi sarcoma-associated herpesvirus infection
    101356099
   05169 Epstein-Barr virus infection
    101356099
   05165 Human papillomavirus infection
    101356099
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101356099
   05142 Chagas disease
    101356099
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101356099
   01524 Platinum drug resistance
    101356099
   01522 Endocrine resistance
    101356099
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101356099
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101356099
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101356099
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 101356099
NCBI-ProteinID: XP_004390917
UniProt: A0A2Y9ED32
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKRERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDSM
DYKCGSPSDSSAAEEMEVAVSKAQAKVTMSDFDYLKLLGKGTFGKVILVREKATGRYYAM
KVLRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEIDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIL
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccagaagcgtggtgaatacatcaag
acctggaggccccgatacttcctgctgaagagtgacggctccttcatcggctataaggag
aggcctgaggcccccgaccagaccctaccccccttaaacaacttctctgtcgccgaatgc
cagctgatgaagagggagaggccacggcccaacacttttgtcatacgctgcctgcagtgg
actacagtcatcgagaggaccttccacgtcgactctccagatgagcgggaggagtggatg
caggccattcagatggtcgccaacagcctcaagcagcggggcccgggcgaggactccatg
gactacaagtgtggctcccccagcgactcttctgcggccgaggagatggaagtggctgtc
agcaaggcgcaggccaaggtgaccatgagtgacttcgactatctcaaactcctcggcaag
ggtacgtttggcaaagtcatcctggtgcgggagaaggctaccggccgctactacgccatg
aaggtcctgcggaaggaggtcatcatcgccaaggatgaagttgcccacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcactgaagtacgccttccag
acccatgaccgcctgtgcttcgtgatggagtatgccaacggtggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgcgcccggttttatggcgccgagatcgtc
tctgccctcgagtacttgcactcgcgggacgtggtgtaccgtgacatcaagctggaaaat
ctcatgctggacaaagatggccacatcaagatcactgactttggcctgtgcaaggagggc
atcagtgacggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcccgag
gtgctggaggacaatgactacggccgggccgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccacgcacgctcagccccgaggccaagtctttg
cttgctgggctgcttaagaaggaccccaagcagaggcttggcggagggcccagcgacgcc
aaagaggtgatggagcacaggttcttcctcagcatcaactggcaggatgtggtacagaag
aagctcctgccacccttcaaacctcaggtcacatctgagatcgacacaaggtacttcgat
gacgagttcaccgcccagtccatcacagtcacacccccggaccgctatgacagcctgggc
tccctagaactggaccagcggacccacttcccccagttctcctactcagccagcatcctc
gagtga

KEGG   Trichechus manatus latirostris (Florida manatee): 101360493
Entry
101360493         CDS       T05135                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu01521  EGFR tyrosine kinase inhibitor resistance
tmu01522  Endocrine resistance
tmu01524  Platinum drug resistance
tmu04010  MAPK signaling pathway
tmu04012  ErbB signaling pathway
tmu04014  Ras signaling pathway
tmu04015  Rap1 signaling pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04066  HIF-1 signaling pathway
tmu04068  FoxO signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04072  Phospholipase D signaling pathway
tmu04140  Autophagy - animal
tmu04150  mTOR signaling pathway
tmu04151  PI3K-Akt signaling pathway
tmu04152  AMPK signaling pathway
tmu04210  Apoptosis
tmu04211  Longevity regulating pathway
tmu04213  Longevity regulating pathway - multiple species
tmu04218  Cellular senescence
tmu04261  Adrenergic signaling in cardiomyocytes
tmu04370  VEGF signaling pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04510  Focal adhesion
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04611  Platelet activation
tmu04620  Toll-like receptor signaling pathway
tmu04625  C-type lectin receptor signaling pathway
tmu04630  JAK-STAT signaling pathway
tmu04660  T cell receptor signaling pathway
tmu04662  B cell receptor signaling pathway
tmu04664  Fc epsilon RI signaling pathway
tmu04666  Fc gamma R-mediated phagocytosis
tmu04668  TNF signaling pathway
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04728  Dopaminergic synapse
tmu04910  Insulin signaling pathway
tmu04914  Progesterone-mediated oocyte maturation
tmu04915  Estrogen signaling pathway
tmu04917  Prolactin signaling pathway
tmu04919  Thyroid hormone signaling pathway
tmu04920  Adipocytokine signaling pathway
tmu04922  Glucagon signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04926  Relaxin signaling pathway
tmu04929  GnRH secretion
tmu04931  Insulin resistance
tmu04932  Non-alcoholic fatty liver disease
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu04935  Growth hormone synthesis, secretion and action
tmu04973  Carbohydrate digestion and absorption
tmu05010  Alzheimer disease
tmu05017  Spinocerebellar ataxia
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05142  Chagas disease
tmu05145  Toxoplasmosis
tmu05152  Tuberculosis
tmu05160  Hepatitis C
tmu05161  Hepatitis B
tmu05162  Measles
tmu05163  Human cytomegalovirus infection
tmu05164  Influenza A
tmu05165  Human papillomavirus infection
tmu05166  Human T-cell leukemia virus 1 infection
tmu05167  Kaposi sarcoma-associated herpesvirus infection
tmu05168  Herpes simplex virus 1 infection
tmu05169  Epstein-Barr virus infection
tmu05170  Human immunodeficiency virus 1 infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05210  Colorectal cancer
tmu05211  Renal cell carcinoma
tmu05212  Pancreatic cancer
tmu05213  Endometrial cancer
tmu05214  Glioma
tmu05215  Prostate cancer
tmu05218  Melanoma
tmu05220  Chronic myeloid leukemia
tmu05221  Acute myeloid leukemia
tmu05222  Small cell lung cancer
tmu05223  Non-small cell lung cancer
tmu05224  Breast cancer
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
tmu05230  Central carbon metabolism in cancer
tmu05231  Choline metabolism in cancer
tmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101360493
   04012 ErbB signaling pathway
    101360493
   04014 Ras signaling pathway
    101360493
   04015 Rap1 signaling pathway
    101360493
   04370 VEGF signaling pathway
    101360493
   04371 Apelin signaling pathway
    101360493
   04630 JAK-STAT signaling pathway
    101360493
   04668 TNF signaling pathway
    101360493
   04066 HIF-1 signaling pathway
    101360493
   04068 FoxO signaling pathway
    101360493
   04072 Phospholipase D signaling pathway
    101360493
   04071 Sphingolipid signaling pathway
    101360493
   04024 cAMP signaling pathway
    101360493
   04022 cGMP-PKG signaling pathway
    101360493
   04151 PI3K-Akt signaling pathway
    101360493
   04152 AMPK signaling pathway
    101360493
   04150 mTOR signaling pathway
    101360493
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101360493
  09143 Cell growth and death
   04210 Apoptosis
    101360493
   04218 Cellular senescence
    101360493
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101360493
   04550 Signaling pathways regulating pluripotency of stem cells
    101360493
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101360493
   04620 Toll-like receptor signaling pathway
    101360493
   04625 C-type lectin receptor signaling pathway
    101360493
   04660 T cell receptor signaling pathway
    101360493
   04662 B cell receptor signaling pathway
    101360493
   04664 Fc epsilon RI signaling pathway
    101360493
   04666 Fc gamma R-mediated phagocytosis
    101360493
   04062 Chemokine signaling pathway
    101360493
  09152 Endocrine system
   04910 Insulin signaling pathway
    101360493
   04922 Glucagon signaling pathway
    101360493
   04923 Regulation of lipolysis in adipocytes
    101360493
   04920 Adipocytokine signaling pathway
    101360493
   04929 GnRH secretion
    101360493
   04915 Estrogen signaling pathway
    101360493
   04914 Progesterone-mediated oocyte maturation
    101360493
   04917 Prolactin signaling pathway
    101360493
   04926 Relaxin signaling pathway
    101360493
   04935 Growth hormone synthesis, secretion and action
    101360493
   04919 Thyroid hormone signaling pathway
    101360493
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101360493
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101360493
  09156 Nervous system
   04725 Cholinergic synapse
    101360493
   04728 Dopaminergic synapse
    101360493
   04722 Neurotrophin signaling pathway
    101360493
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101360493
  09149 Aging
   04211 Longevity regulating pathway
    101360493
   04213 Longevity regulating pathway - multiple species
    101360493
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101360493
   05205 Proteoglycans in cancer
    101360493
   05230 Central carbon metabolism in cancer
    101360493
   05231 Choline metabolism in cancer
    101360493
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101360493
  09162 Cancer: specific types
   05210 Colorectal cancer
    101360493
   05212 Pancreatic cancer
    101360493
   05225 Hepatocellular carcinoma
    101360493
   05226 Gastric cancer
    101360493
   05214 Glioma
    101360493
   05221 Acute myeloid leukemia
    101360493
   05220 Chronic myeloid leukemia
    101360493
   05218 Melanoma
    101360493
   05211 Renal cell carcinoma
    101360493
   05215 Prostate cancer
    101360493
   05213 Endometrial cancer
    101360493
   05224 Breast cancer
    101360493
   05222 Small cell lung cancer
    101360493
   05223 Non-small cell lung cancer
    101360493
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101360493
   05017 Spinocerebellar ataxia
    101360493
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101360493
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101360493
   04931 Insulin resistance
    101360493
   04933 AGE-RAGE signaling pathway in diabetic complications
    101360493
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101360493
   05135 Yersinia infection
    101360493
   05152 Tuberculosis
    101360493
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101360493
   05170 Human immunodeficiency virus 1 infection
    101360493
   05161 Hepatitis B
    101360493
   05160 Hepatitis C
    101360493
   05164 Influenza A
    101360493
   05162 Measles
    101360493
   05168 Herpes simplex virus 1 infection
    101360493
   05163 Human cytomegalovirus infection
    101360493
   05167 Kaposi sarcoma-associated herpesvirus infection
    101360493
   05169 Epstein-Barr virus infection
    101360493
   05165 Human papillomavirus infection
    101360493
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101360493
   05142 Chagas disease
    101360493
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101360493
   01524 Platinum drug resistance
    101360493
   01522 Endocrine resistance
    101360493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101360493
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101360493
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101360493
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101360493
NCBI-ProteinID: XP_004376815
UniProt: A0A2Y9DMB0
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEIMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEERARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGAEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECADSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccattgtgaaggagggctggttgcacaagcgaggtgagtacatcaag
acctggcggccacgctacttcctcctcaagaatgacggcaccttcatcggctacaaggag
cgtccacaggacgtggaccagcgcgagtctcccctcaacaacttctctgtggcacaatgc
cagctgatgaagacggagcggcccaggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcattgagcgcaccttccacgtggagacgcctgaggagcgggaggagtggacc
acggccattcagacggtggcggacgggctcaagaggcaggaggaggagataatggatttc
cggtcaggctcacccagcgacaactcgggggctgaggagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagttcgagtacctgaagctcctggggaaaggcacc
tttgggaaggtgatcctggtgaaggagaaggccacaggccgttactacgccatgaagatc
ctgaagaaggaggtcatcgtggccaaggacgaggtggcacacacactcactgagaaccgt
gtcctccagaactccaggcacccttttctgacagccctgaagtactccttccagacccac
gaccgcctctgctttgtcatggaatacgccaacgggggcgagctcttcttccacctgtcc
cgggagcgcgtgttctccgaggagcgggcccgcttctacggggccgagattgtgtcggcc
ctggactacctgcactcggagaagaacgtggtctacagagacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcacggacttcgggctgtgcaaggagggcatc
aaggacggcgccaccatgaagaccttctgtggcacgccggagtacctggcccctgaggtg
ctggaggacaacgactatgggcgggccgtggactggtggggcctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgaactc
atcctcatggaggagatccgtttcccgcgcacgcttagccctgaggccaagtcgctgctc
tccgggctgctcaagaaggaccccaagcagaggctcggcgggggtgccgaggacgccaag
gagatcatgcagcaccgcttcttcgccagcatcgtgtggcaggatgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacgtcggagacagacacccggtatttcgatgag
gagttcacagcccagatgatcaccatcacgccgcccgaccaagatgacaacatggagtgt
gcggacagcgagcgcaggccccacttccctcaattctcctactcagccagcggcacagcc
tga

DBGET integrated database retrieval system