KEGG   Trichechus manatus latirostris (Florida manatee): 101358763
Entry
101358763         CDS       T05135                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04068  FoxO signaling pathway
tmu04110  Cell cycle
tmu04310  Wnt signaling pathway
tmu04350  TGF-beta signaling pathway
tmu04371  Apelin signaling pathway
tmu04390  Hippo signaling pathway
tmu04520  Adherens junction
tmu04550  Signaling pathways regulating pluripotency of stem cells
tmu04659  Th17 cell differentiation
tmu04933  AGE-RAGE signaling pathway in diabetic complications
tmu05161  Hepatitis B
tmu05166  Human T-cell leukemia virus 1 infection
tmu05200  Pathways in cancer
tmu05210  Colorectal cancer
tmu05212  Pancreatic cancer
tmu05220  Chronic myeloid leukemia
tmu05225  Hepatocellular carcinoma
tmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101358763
   04350 TGF-beta signaling pathway
    101358763
   04390 Hippo signaling pathway
    101358763
   04371 Apelin signaling pathway
    101358763
   04068 FoxO signaling pathway
    101358763
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101358763
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101358763
   04550 Signaling pathways regulating pluripotency of stem cells
    101358763
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101358763
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101358763
  09162 Cancer: specific types
   05210 Colorectal cancer
    101358763
   05212 Pancreatic cancer
    101358763
   05225 Hepatocellular carcinoma
    101358763
   05226 Gastric cancer
    101358763
   05220 Chronic myeloid leukemia
    101358763
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101358763
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101358763
   05161 Hepatitis B
    101358763
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 101358763
NCBI-ProteinID: XP_023589723
UniProt: A0A2Y9RDV5
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLPTEGHSIQ
TIQHPPSNRASAETYSTPALLASSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaggatgaattggattctttaataacagct
ataactacaaatggagcgcatcctagcaaatgtgttaccatacagagaacactggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatatatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgacagtgtctgtgtgaatccttatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggac
gaatatgttcatgactttgagggacagccatcgttacccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcatcagcggagacatacagcactccagctctt
ttagcctcatctgagtctaatgctacgagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggactgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtagaaccgcaccatacacacctaatttg
cctcaccaccaaaatggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccatctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccacgcagtctttgtacagagttactatttagacagagaagccggacgt
gcacctggagatgctgttcataagatctacccaagtgcgtatataaaggtctttgatttg
cgtcagtgtcatcgtcagatgcagcagcaggcggccacggcacaagctgcagccgccgcc
caggcagcagccgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtttgtctgctgctgccggaattggtgtggatgaccttcgtcgcttgtgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaaggcagagcatcaaggaa
acaccttgctggattgagatccacctacaccgggccctgcagcttctagatgaagtcctt
cacaccatgcctattgcagacccacaacctttagactga

DBGET integrated database retrieval system