KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00021989G001
Entry
GSTEN00021989G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng01100  Metabolic pathways
tng04020  Calcium signaling pathway
tng04114  Oocyte meiosis
tng04261  Adrenergic signaling in cardiomyocytes
tng04270  Vascular smooth muscle contraction
tng04371  Apelin signaling pathway
tng04540  Gap junction
tng04912  GnRH signaling pathway
tng04914  Progesterone-mediated oocyte maturation
tng04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00021989G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    GSTEN00021989G001
   04020 Calcium signaling pathway
    GSTEN00021989G001
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    GSTEN00021989G001
  09144 Cellular community - eukaryotes
   04540 Gap junction
    GSTEN00021989G001
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    GSTEN00021989G001
   04914 Progesterone-mediated oocyte maturation
    GSTEN00021989G001
   04916 Melanogenesis
    GSTEN00021989G001
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    GSTEN00021989G001
   04270 Vascular smooth muscle contraction
    GSTEN00021989G001
Enzymes [BR:tng01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     GSTEN00021989G001
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-ProteinID: CAG02779
UniProt: Q4S9A3
LinkDB
Position
undetermined
AA seq 1292 aa
MPRNRAFSEPECSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYVIVMCAVVFSGDKLAAVLVASLGLLADVL
LYLLCRLGLLPDRVSRRVVPYALWLLIAAQIFCYLGLNYAHRHQSSDTVGWQAFFCFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQEHIQGPELGRQLLANVVIYACAITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVRYTHRAYADPHVRATERLCACGLVSILFADIVGFTQLSSSCS
AQELVKLLNELFARFDKLAAVSPDSRSHSKYHQLRIKILGDCYYCICGLPDYREDHAACS
IMMGLAMVEAISYVREKTQTDVDMRVGVHSGTVLGGVLGQKRWQYDVWSTDVTVANKMEA
GGIPGRVHISQSTLECLHGEFDVEPGNGGERCDYLRERGIETYLVVVPKAPAGKNNGVNG
VKLSVTSSNGNSPQLINTTECNGSVNTACTTPEDPEELDARVVNPSFPNPRRRLRLRDLA
ERVIDAQENEQELNKLLNEALLERETVQALKGKHTNRLSLRFVDPDLETRYSVEKEKQSG
AAFCCSCVVLLCTTLMEALIDPWLIANYVTFAAGEVLLLVLTVCSLAAIFPRVFPKKLVS
FSTWIDHTRWARNTWAMAAIFILTVADTADMLSCLSRVPDSGGIAVAPSSTSSLSGHIGC
FSNPKYYSYTAVLALMATTMLVQVSHMVKVTLMLLITTATGVVNIHSWRDIFDHYDTARF
QDYRLNSCPALRCAVLMQHFLLVCRSHMVPSKITMTLMILIMMVSFYYFSRHVEKLARTL
FLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEVRSLASACKRGARPF
QAPSRPGILEEMWWVRLELYSQSYEEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEI
ISDFDSVSCRPPPAFTCARVHGSVTCDLCSRQLLDEPQFRCITKIKTIGSTYMAASGVTP
DVNNGYSCMKVSEGEEGQPAWGPPPGPEPTVVVLSSQKEERSDRERWQHLADLADFALAM
KVTLMNINYQSFNNFMLRIGLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNI
QVCPGCAFAPDTKTTTLAGVCVGLTAGVCPLFQVVEECYSILKEYGFRFVRRGPIFVKGK
GELLTYFLKGRDKQGSFINGSSVNLPHQVVDS
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgcctcggaaccgggccttctccgagcccgagtgctcggccgagtactcggccgactgc
tcggtcacgctgccctccgaccccggccaggcggtggggaggacccacgaggtgacggtg
cgcagctccggctgctgcctgtgcctgccgcgcttcatgcgcctgaccttcgcccccgag
tccctggagaacctgtaccagacctacttccggcggcagaggcacgaaaccctgctggtg
ctggtggtgtttgccgccctcttcgacagctacgtcatcgtcatgtgcgccgtggtcttc
agcggcgacaagctggccgccgtcctggtggcctcgctggggctgctggccgacgtgctc
ctctacctgctgtgtcgcctggggctgctgcccgaccgcgtctcccggcgggtggtgccc
tacgccctgtggctgctgatcgccgctcagatcttctgctacctgggcctgaactacgcc
caccgccaccagagcagcgacacggtgggctggcaggccttcttctgcttctccttcttc
ctgacgctgccgctgaggctcacgcccatcgtgctgatcaccaccgtgtcctgcggcgtg
cacaccctggtcctgggagtcaccatcgcccagcagcagcaggagcacatccagggcccc
gaactgggcagacagcttctggctaacgttgtgatctacgcctgtgccatcacggtgggc
atcatgtcgtactacatggccgaccgcaaacaccgcaaggccttcctggaggccaggcag
tccctggaggtgaagctgaacctggaggagcagagccagcagcaggagcgtctgctgctc
tccatccttccgaagcacatcgccgatgagatgctgcaggacatgaagaaggagcccagt
cagaaggagatgcagcagttcaacaccatgtacatgtacaggcacgagaacgtcaggtac
acacaccgcgcctacgccgacccacacgtgagggccacagagcgactgtgcgcctgtggt
cttgtcagtattctgtttgcagacatcgtgggcttcacccagctgtcctcgtcctgcagc
gctcaggagctggtcaagctgctcaacgagctcttcgctcgcttcgacaagctagccgcc
gtgagtcccgacagccggagccactcgaaataccaccagctgaggatcaagatcctggga
gactgctactactgcatctgcggcctgcccgactacagggaggaccacgccgcctgctcc
atcatgatgggcctggccatggtggaggccatatcgtacgtcagagagaaaacccagacg
gacgtggacatgcgcgtcggagtgcacagcggcacagtcctggggggggtcctgggtcag
aagcgctggcagtacgacgtctggtccaccgacgtgaccgtggctaacaagatggaggcg
ggggggatcccagggcgcgtccacatctcgcagagcaccctggagtgtcttcacggcgag
tttgacgtggagccggggaacggaggagagcgctgcgactacctgagggagcgcggcatt
gagacctacctggtggtggttcccaaggccccggcgggaaagaacaacggcgtcaacggc
gtgaagttgtctgtaacttcctccaacggaaattcgccgcagctgatcaacaccacggag
tgcaacggcagcgtgaacacggcctgcaccacaccggaggacccggaggagctggacgcc
agggtggtgaacccgtcctttcctaaccctcgtcgacggctccggctgagggacctggct
gagcgggtgatcgatgcgcaggagaacgagcaggagctgaacaagctgctgaacgaggct
ctgctggagagggagacggtgcaggcgctgaaggggaagcacaccaaccggctgtccctg
cgctttgtggaccccgacctggagacgcgttactccgtggagaaggagaagcagagcgga
gcggccttctgctgctcctgcgtggtgctgctctgcaccacactgatggaggccctcatc
gacccctggctgatcgccaactacgtcaccttcgcggcgggcgaagtcctgctgctggtg
ctaaccgtctgctctttggccgccatctttcctcgagtctttcccaagaaactggtgtcc
ttctccacctggattgaccacacgcgctgggctcgcaacacctgggccatggcggccatc
ttcatcctcacggtggccgacacggcggacatgctgagctgtctgtctcgggtcccggac
tcgggcggcatcgcggtggctccttcctctacctcctccttgtctggccacatcggttgc
tttagcaaccccaagtattacagctacacggctgtgctggccctgatggccaccaccatg
ctggttcaggtcagtcacatggtcaaggtcacgctgatgctgctcatcaccacggccacc
ggtgtggttaatatccacagctggagggacatctttgaccactacgacacggcccgcttc
caggactacaggctaaatagttgcccagccctgcgctgcgcggtgctaatgcagcatttc
ctgcttgtctgcaggtcacacatggtgccttccaagatcaccatgacactgatgattctc
atcatgatggtcagcttctactatttctcccgacatgtggagaagctagcccgcacgctc
ttcctgtggaaaatcgaggtccacgagcagaaggagaaggtgtacgagatgaggcgctgg
aacgaagccttggtgaccaacatgctaccggaacacgtcgcgcggcacttcttgggctcc
aagaagagggacgaggtgaggtccttggcctcggcctgcaaacgtggagcacgcccattc
caggctccttccaggcctggaatcctggaggagatgtggtgggtgcggttggagctgtac
agccagtcgtacgaggagatcggagtcatgtttgcctccatcccaaacttctccgacttc
tacacggaggagagcatcaacaacggcggcatcgagtgtctgcgcttcctcaacgagatc
atctctgactttgacagtgtgagctgccgtcctcctcctgcgttcacgtgcgcgcgtgtc
cacggtagcgtgacctgtgacctgtgttcacggcagctgctggacgagccgcaattccgc
tgcatcacaaaaatcaagaccatcggcagcacctacatggccgcctcgggggtcacgcca
gacgtcaacaacgggtactcctgcatgaaggtcagcgagggagaggagggccaaccggcc
tgggggccgcccccgggcccggaacccaccgtcgttgttctttcttcccagaaggaggag
cggtcggacagggagcgctggcagcacctggcagacctggcggactttgctctggctatg
aaggtcacgctcatgaacatcaactaccagtccttcaacaacttcatgctgcgcatcggt
ctgaataaaggcggagttttagccggagtgatcggagccaggaagcctcactacgacatc
tggggcaacaccgtcaacgtggccagtcgcatggagtccacgggggtgatggggaacatc
caggtgtgtccgggatgcgcctttgctccagacaccaaaacaacaacacttgcaggtgtg
tgtgttggtctgacagctggtgtgtgtcctctctttcaggtggtggaggagtgctacagc
atcctgaaggagtacggcttcaggttcgtgaggagggggcccatcttcgtcaaggggaag
ggggagctgctcacctactttctcaagggaagagacaaacagggctcattcatcaacggt
tcctctgtcaacctgccacaccaggtagtggacagc

DBGET integrated database retrieval system