KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00023793G001
Entry
GSTEN00023793G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05459  insulin-like growth factor 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04114  Oocyte meiosis
tng04115  p53 signaling pathway
tng04150  mTOR signaling pathway
tng04510  Focal adhesion
tng04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00023793G001
   04068 FoxO signaling pathway
    GSTEN00023793G001
   04150 mTOR signaling pathway
    GSTEN00023793G001
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    GSTEN00023793G001
   04115 p53 signaling pathway
    GSTEN00023793G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00023793G001
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    GSTEN00023793G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tng04052]
    GSTEN00023793G001
Cytokines and growth factors [BR:tng04052]
 Growth factors
  Growth factors (RTK binding)
   GSTEN00023793G001
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-ProteinID: CAG04155
UniProt: Q4S5C7
LinkDB
Position
19
AA seq 125 aa
MSSALSSQWHLCDVFKSAMCCISCSHTLSLLLCILTLTPTATGAGPETLCGAELVDTLQF
VCGERGFYFSKPTGYGTNSRRSSGIVEECCFQSCDLWHLEMYCAPAKTNKPRTQRHTDKT
RAPKA
NT seq 375 nt   +upstreamnt  +downstreamnt
atgtctagcgcgctttcctctcagtggcatttatgtgatgtcttcaagagtgcaatgtgc
tgtatctcctgtagccacaccctctcgctactgctctgcatcctcaccctgactccgacg
gcaacaggggcgggcccggagacgctgtgcggggcggagctggttgacacgctgcagttt
gtgtgtggagagagaggcttttatttcagcaagcccacaggctatggcaccaactcccgg
cggtcgagcggcatcgtggaggagtgctgcttccaaagctgcgacctgtggcatttggag
atgtactgtgcccccgccaagaccaacaagccccgcacgcagcgccacacagacaagacc
agagcgccaaaggcc

DBGET integrated database retrieval system