KEGG   Thalassolituus oleivorans MIL-1: TOL_0612Help
Entry
TOL_0612          CDS       T02529                                 

Definition
(GenBank) manganese superoxide dismutase Mn-SOD
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tol  Thalassolituus oleivorans MIL-1
Brite
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TOL_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCU71050
UniProt: M5DMF4
LinkDB All DBs
Position
complement(643326..643907)
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYEKTALEPHISAETLDFHHGKHHNTYVQKLNGLIGGTEFEGKTLEEIIKTS
SGGVFNNAAQIWNHTFYWNSLSPNGGGEPTGAIADAITAAFGSFADFQAKFNDSAVNNFG
SSWTWLVKKADGSLDIVNTSNAATPITEEGVTPLLTVDLWEHAYYIDYRNVRPDYLKGFW
ALVNWDFANANFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgaacttcctgctctaccgtacgaaaaaactgctctagaacctcatatttct
gcagaaacattagattttcaccacggtaagcatcacaacacttacgttcaaaagttgaac
ggcttaatcggtggtactgaattcgaaggtaaaaccctagaagaaatcatcaagacttca
tctggtggtgttttcaataacgctgctcagatctggaaccacactttctactggaatagc
ctaagccctaacggtggtggcgagcctactggcgcaattgccgacgcaattaccgctgcg
ttcggatcttttgctgatttccaagctaaattcaacgacagcgcagtgaacaactttggt
tcaagctggacttggttagttaagaaagcagatggttctttagacatcgtaaacacgtca
aacgctgcaacccctatcaccgaagaaggtgttacaccgttgttgactgttgatttgtgg
gaacacgcttactacatcgattaccgcaacgtgcgtcctgattacctgaaaggtttctgg
gcactggttaactgggacttcgcgaacgctaacttcgcttaa

DBGET integrated database retrieval system