KEGG   Thalassolituus oleivorans MIL-1: TOL_3193Help
Entry
TOL_3193          CDS       T02529                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tol  Thalassolituus oleivorans MIL-1
Brite
KEGG Orthology (KO) [BR:tol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TOL_3193
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TOL_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C NAD_binding_7 FAD_binding_3 NAD_binding_8 Thi4 NAD_binding_9 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: CCU73589
UniProt: M5DVM6
LinkDB All DBs
Position
complement(3352911..3354464)
Genome map
AA seq 517 aa AA seqDB search
MLDATMKQQLGAYLNNLRNPIELLVSVNDSPKSKELEELANEIAALNDKISVNTTSDKIG
GRSPVMTIAKEGTEARVAFAGVPMGHEFTSLVLALLQAGSHPSKEAQALQDQTKSLSREL
NFEVYVSLSCHNCPDVVQAVNLMAALNPKITATMIDGGVFPDEVKQRDIMAVPSLYLNGE
LFGNGKMTLAEILNKVDDEADAKAAAALADKAPYDVLVVGGGPAGASAAIYAARKGIRTG
IVAERFGGQVSDTVGIENFISVKYTEGPKLVAHLEEHVKEYDVDVMNTQKVVAVRKIDSG
LSEVELANGAVLSSKSVILATGARWREMNVPGEEQYRNKGVAYCPHCDGPLFKGKKVAVI
GGGNSGIEAAIDLAGIVAHVTVLEFADTLRADAVLVKKAQSMSNITIIKQAMTTEVLGDG
TRVTGLQYKDRATDEMHVVELAGIFVQIGLVPNTEFLKETVGLTQRGEIVIDGHGQTNLP
GIFAAGDCTNVAYKQIIISMGAGATAALGAFDYLIRN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcaacgatgaaacaacaattgggcgcctacttaaacaatctgcgtaatccg
attgaattattggtgtctgttaatgattcgccaaaatcgaaggagctagaagagctagct
aacgagattgcggcactgaatgacaaaatttcggtgaatacgacgtccgataaaatcggt
ggtcgctcgccagtgatgacgattgccaaagaaggcaccgaggcacgtgtcgcgtttgct
ggggtgccaatgggtcatgaatttacttcgttggttttggcgctattgcaagcgggcagt
catccatcaaaagaagcgcaggctttgcaggatcaaactaagtcactgagtcgcgaactg
aacttcgaagtgtacgtgtcgctatcgtgtcacaactgcccagacgttgttcaggccgtt
aacttgatggcagctttaaatccaaaaatcaccgccactatgattgatggcggtgtattt
ccggatgaagtaaaacagcgcgatattatggcggtaccctcgctttacctaaatggtgag
ttattcggcaacggcaaaatgaccttggcggaaattctcaataaggttgatgacgaagcg
gatgccaaagctgcagccgctttggcagataaagcaccttatgacgttttagtcgttggt
ggtggtcccgctggggcttccgctgcgatttatgcggcgcgtaaaggcattcgcaccggt
attgttgccgagcgtttcggtggccaagtatctgatactgtgggtatcgagaactttatt
tcggtgaaatataccgagggtccaaaactggttgcgcatttagaagagcacgtcaaagaa
tatgatgttgacgtgatgaacacgcaaaaagttgtggcggtgcgtaaaattgattctggt
ttaagtgaagttgaattagctaacggtgccgtattgagcagcaaatcagtcattttggcc
acgggtgcgcgctggagagaaatgaacgtgccgggcgaagagcaatatcgtaataaggga
gttgcctactgcccacactgcgacggcccgttattcaaaggcaaaaaagtcgcagtcatt
ggtggtggtaattcaggtattgaggcggcgattgatttagccggtatcgttgctcatgtc
acggtattggaatttgccgatacgctgcgcgctgatgcggtattggtgaaaaaagcgcaa
tctatgagtaatatcaccattattaaacaagccatgaccaccgaagtgctgggcgatggt
actcgcgtgactggcttgcaatacaaagatcgcgccactgatgagatgcatgttgttgaa
ttggcgggtatttttgttcaaatcggcttagtacctaataccgaattcttaaaagaaacg
gtaggcctgactcagcgcggtgaaattgtcattgacggtcatggtcaaaccaatctacct
ggtatcttcgccgctggcgactgtacgaacgtagcgtacaaacaaatcattatttctatg
ggagcaggtgcgacagctgcattgggcgcttttgactaccttatccgtaattaa

DBGET integrated database retrieval system