Tateyamaria omphalii: BWR18_17360 Help Entry BWR18_17360       CDS       T04652                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tom  Tateyamaria omphalii Brite KEGG Orthology (KO) [BR:tom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tom03032]     BWR18_17360    03036 Chromosome and associated proteins [BR:tom03036]     BWR18_17360    03400 DNA repair and recombination proteins [BR:tom03400]     BWR18_17360 DNA replication proteins [BR:tom03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BWR18_17360 Chromosome and associated proteins [BR:tom03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BWR18_17360 DNA repair and recombination proteins [BR:tom03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BWR18_17360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  APX13253 UniProt:  A0A1P8MYY1 LinkDB All DBs Position complement(3466328..3466615) Genome browser AA seq 95 aa AA seqDB search MAKPMTKTQLVAALAEEMGTDKKSAGGALDAICGLITKEVSGGGAVTLPGVGKIYCRERP ERMVRNPATGEQFKKEADKVVKMTIAKALKDSVNE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaccaatgacaaaaacccaactcgtcgccgcgctggccgaagaaatgggaaca gacaagaaatccgcaggcggcgctctggacgcgatctgcggcctgatcaccaaggaagtg tcgggcggcggcgccgtgaccctgccgggcgtcggcaagatctattgccgcgagcgtccc gagcgcatggtgcgcaaccccgccaccggcgaacagttcaaaaaagaggcggacaaggtc gtcaaaatgaccatcgccaaagcgttgaaagacagcgtgaacgaataa

DBGET integrated database retrieval system