KEGG   Thalassolituus oleivorans R6-15: R615_04295Help
Entry
R615_04295        CDS       T03056                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
tor  Thalassolituus oleivorans R6-15
Brite
KEGG Orthology (KO) [BR:tor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R615_04295
Enzymes [BR:tor01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     R615_04295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AHK15203
UniProt: W8G359
LinkDB All DBs
Position
929900..930571
Genome map
AA seq 223 aa AA seqDB search
MLELYSAATPNGWKATVLLEELQLPYTLTPIDLGRNAQKEAWFLKINPNGRIPALIDHGE
DDFAVFESGAIMIYLAEKAGKLLGNNAKEKSQVIQWLMFQMGGVGPMMGQANVFFRYFPE
KIQPAIDRYQNEGRRLLTVLDSALAERDYLVGENRGEYSVADIANWCWAHTYEWSGIDIS
GLDNLQAWIQRIRERPAVQAGIRLPARGDKDTVTQTGQTIIQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgttagagctatacagtgcagcaacgccgaatggttggaaagccacggtgttactcgaa
gaactgcaacttccgtatacgttgacgccgattgatttgggccgtaatgcacagaaagaa
gcatggtttttaaagatcaatccgaatggtcgaattcctgcgttaattgatcatggcgaa
gacgattttgcggtatttgaatcgggcgcaattatgatttatctagctgaaaaggctggt
aaattactgggcaataacgctaaagaaaaatctcaagtgatacagtggttaatgtttcaa
atgggcggagtcggccccatgatgggacaagccaacgtcttttttcgctatttccccgag
aaaattcaaccggcgattgatcgttaccaaaacgaggggcggcgattgttgactgtactg
gattcagcattagcagaacgtgactatttagttggcgaaaatcgtggagaatacagcgtt
gccgatatcgctaactggtgctgggctcatacttacgagtggtcgggtattgatatttca
gggctcgacaacctgcaggcttggattcaacgaattcgtgagcgtcctgcggtgcaagcc
ggtattcgcttgcctgctcgcggcgataaagatacggttacgcaaacggggcagacgatt
attcaaaaatag

DBGET integrated database retrieval system