KEGG   Treponema primitia: TREPR_2775Help
Entry
TREPR_2775        CDS       T01507                                 

Gene name
malP
Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tpi  Treponema primitia
Pathway
tpi00500  Starch and sucrose metabolism
tpi01100  Metabolic pathways
tpi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TREPR_2775 (malP)
Enzymes [BR:tpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TREPR_2775 (malP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 DUF2015
Motif
Other DBs
NCBI-ProteinID: AEF84447
UniProt: F5YQG3
LinkDB All DBs
Position
1404662..1407202
Genome map
AA seq 846 aa AA seqDB search
MNISTYTIKPKLPNSLKPLEELARNLWLSWNFDAVQLYIRLDYDVWLQSQQSPVRTLGMV
SQERLAEVAKDDSYLSALNEVYGRFLKYKKGETWYRGSRKDVVAYFSMEYGMDVSLPIYS
GGLGMLSGDHMKTSSDMGLPLVGIGLLYRQGYFKQYLNADGFQQETYPENDWYNMPVERK
NDKNGNPLKISVDLAGRVAVAQIWEVKVGRSFLYLLDTNIEENAQDFRNITSALYGGDKE
TRIQQEILLGIGGIRALRALGINPAATHMNEGHAAFLGLERVREIMVEKHFNFDEAREVV
WPTNIFTTHTPVPAGNERFDIGLIEKYFRPWTQTLGISWKDFLGLGRERVYDDHEPFCMT
VLALKMAAYANGVSKLHGEVSRIMWKGLWPNLPLEEIPISHVTNGVHPRTWVSNNMTDLL
DRYFGTHFNDEPTDLAIWDRMDRISDEELWRTHERRRERLVAFARDRIRQNLKRNGAVER
RIQKAEDALSPYVLTLAFARRFATYKRGNLLLRDPDRLLRLLRDKDRPIQLIFAGKAHPM
DMPGKELIKEIIHFAEHHDVESRIIFLENYDMTMGHYLTAGADVWLNTPRRPLEASGTSG
MKASMNGVLNCSILDGWWDEAYNPEVGWAIGRGEEYEDTKLQDEVESKALYDLLEREIIP
LFYQRGRDGLPREWIKMMKTCMKEIGHSMSSHRMLMDYSNKFYFPALKNYRRLVKDDYTE
AKSLAAYMTKLHQSWDSLKINKVESNSKPVMQRGDSLTVSATIELGALKPEDVLVELYHG
TVSNQGNDITNARRTEMKPLGQQGNSYQYQVRIECADTGQQGHTVRILPKHEALVHPYRT
GLIKWA
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatctacttatacgattaaaccgaaacttcctaattcccttaagcctttggaa
gagcttgcccgcaatctctggctttcctggaatttcgacgcagttcagctctatatcagg
ctggattacgatgtctggctacaatcccagcaaagtcccgtccggaccttgggtatggtc
agccaggaacggctggcggaagttgccaaggatgattcgtatctttccgcacttaacgag
gtttacggtcgttttttgaagtataaaaaaggcgaaacctggtataggggttcacggaag
gatgtggttgcctatttctccatggaatacggcatggatgtgtccctgcccatctattca
ggcggcctgggtatgctttccggggaccacatgaaaacctcctccgacatggggctgcct
ctggtgggcatcggcctcctgtatcggcagggctattttaagcaatacctcaatgccgat
gggtttcagcaggaaacctacccggaaaacgactggtataacatgcccgtggagcggaaa
aacgacaaaaacggtaatcctttgaaaatttccgtagatctggcgggccgtgtggcggta
gcccagatctgggaggtcaaagtaggccgcagtttcttgtatctgctggatactaatatt
gaagaaaacgcccaggatttccggaacattacctccgccctctatggcggggacaaagaa
actcggattcagcaggaaatactcctgggtatcgggggcatacgggcactccgggccctg
gggatcaaccctgcggctacccacatgaacgaaggccatgcggctttcctgggcctggaa
cgggtccgggaaatcatggtggaaaagcactttaactttgacgaagcccgggaagtggtg
tggcctaccaatatctttaccacccataccccggttcctgcgggaaacgagcgctttgat
atcggccttatcgaaaaatatttccggccctggacccaaaccctgggcatttcctggaag
gatttcctgggcctcggccgggaacgggtctacgatgaccacgagccgttctgcatgacc
gtcctggctctgaaaatggccgcctatgccaacggggtttccaagctccacggcgaggtt
tcccggattatgtggaagggtctctggcccaaccttcccctggaagaaatacctatcagc
catgtaaccaacggggtgcatccccggacctgggtttccaataacatgaccgacctcttg
gatcggtattttggcacccactttaatgatgaacctacagatttagcaatctgggaccgc
atggaccgcatctccgatgaggaactatggcgcacccatgagaggcgccgtgaacggttg
gttgcctttgcccgggaccggatcaggcagaacctcaagcgcaacggcgcagtggaacgg
cgtatccagaaagctgaagacgccctttctccctacgtgctgaccctggcttttgcccgc
cgtttcgccacctataagcggggtaacctgctgcttcgtgacccggaccggctgcttcgt
ctcctcagggacaaggatcggcccatacagctgatttttgccggtaaagcccatcccatg
gacatgcccggcaaggaactgattaaagagatcatccactttgcggaacaccacgatgtg
gaaagccggatcattttcctggaaaattacgacatgaccatgggccactacctcaccgcc
ggtgcagacgtatggctcaataccccccgccgccctctggaagcctcgggcaccagcggt
atgaaggcctccatgaacggggtcctcaactgctccatcctggacggctggtgggacgaa
gcctacaaccccgaagtgggctgggccataggccggggcgaagaatacgaggatacaaaa
ttgcaggacgaagtggagagcaaggccctctacgatctcctggaacgggagataatcccc
ctgttctaccagcgcggtcgtgacggcctgccccgtgaatggatcaagatgatgaagacc
tgtatgaaggaaatcggtcattccatgtccagccatcgtatgctcatggattattccaac
aagttctacttcccggccctgaagaactaccgccgcctggtcaaagacgactataccgag
gctaaatccttggcagcctatatgaccaagctccaccagtcctgggactccctgaagatc
aacaaggttgaatccaactccaaaccggtgatgcagcggggggattccctcactgtaagc
gccaccatagagctgggcgccctgaagcccgaagacgttctggtagagctgtaccacggt
accgtatccaaccagggcaacgatattaccaatgcccggcgtacagaaatgaaaccctta
ggccagcaaggcaacagctaccagtatcaggtgcgtatcgaatgcgccgacaccggccag
cagggccacacggtccgcatactacccaagcatgaggctttggtccatccatatcggacc
gggctgattaagtgggcgtag

DBGET integrated database retrieval system