KEGG   Thermococcus piezophilus: A7C91_08000Help
Entry
A7C91_08000       CDS       T04941                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tpie  Thermococcus piezophilus
Pathway
tpie00260  Glycine, serine and threonine metabolism
tpie01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpie00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7C91_08000
Enzymes [BR:tpie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     A7C91_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ANF23113
UniProt: A0A172WI23
LinkDB All DBs
Position
complement(1463191..1464243)
Genome map
AA seq 350 aa AA seqDB search
MEGKMPAIVKTKPAYGAELVEVDIPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
TPQIMGHEVAGEVVEVGPGVDTIQVGDYISAETHIVCGKCYACKHNRYHVCQNTKIFGVD
MDGVFAEYAIVPAQNAWKNPKNMPPEYASLQEPLGNAVDTVLAGPIVGRSTFITGAGPLG
LLGIAVAKAAGAYPVIVSEPSEFRRKLAKKVGADYVVNPFEEDPVKFVMDITDGAGVEVF
LEFSGAPKALEQGLQAVTPGGRVSLLGLFPREVTFDVNNLVIFKALEVHGITGRHLWETW
YTVSSLIQSGKLNLDPIITHKYNGFDKFEEAFELMRAGKTGKVVFFPHKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaagatgccagccatcgtgaaaacgaagcccgcttacggtgcggagctcgtt
gaagttgatatccccaaacccggtcccggagaggttctcatcaaggttctcgctacgagc
atctgtggaaccgatttgcacatatacgagtggaacgaatgggcccagagcagaatcaaa
actcctcagattatgggacacgaggtcgctggagaggtcgtagaggttggccccggcgtc
gatacaatccaggttggggattacatttcagctgagacccacatcgtctgtggaaaatgt
tacgcctgtaagcataaccgctaccacgtctgccagaacaccaagatattcggcgtcgac
atggacggtgtcttcgctgaatacgccatagttccagcccagaacgcctggaagaacccg
aagaacatgccgcccgagtatgcaagccttcaggagccccttggaaacgcggtcgataca
gttttagctggtccgatagtcgggagaagcaccttcataaccggagccggtccgctcggc
ctgcttggaatcgccgttgcaaaagctgctggcgcttatccagtcatcgtcagcgagccg
agcgagttcaggagaaaactagcgaaaaaggtcggcgccgactacgtcgtcaacccattc
gaggaggatccggttaagttcgtaatggacataactgacggagccggtgttgaggtgttc
ttagagttcagcggggcaccaaaggcattggagcagggactccaggcggtaaccccggga
ggaagggtttcgctgctcggcctcttcccgagggaggtcaccttcgacgtcaacaacctc
gtaatcttcaaggccctcgaagttcacggcataaccggaagacacctctgggagacctgg
tataccgtctcaagcctcatccagagcggcaagctcaacctcgacccgataatcacccac
aagtacaatggcttcgacaagttcgaggaagccttcgagctcatgcgcgcgggcaagact
ggaaaagttgtcttcttcccccacaagaagtga

DBGET integrated database retrieval system