KEGG   Thalassiosira pseudonana: THAPSDRAFT_899
Entry
THAPSDRAFT_899    CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00620  Pyruvate metabolism
tps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THAPSDRAFT_899
Enzymes [BR:tps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     THAPSDRAFT_899
SSDB
Other DBs
NCBI-GeneID: 7451500
NCBI-ProteinID: XP_002285950
JGI: 899
UniProt: B8BSR8
LinkDB
Position
1
AA seq 1175 aa
MANTNLHGEDLIRHCGLNDNGKAVEQMDPHSFHRLIAVKLASQGFEVPQARNGNEVAENQ
VLQLASDLFRRYAEQSRLLTGHLNPPDRRIQDFLDDALASTGVKVELPTNVINMDRYGMA
RKLSLPDDPSATEFHNSEVSSYNLCNGVLHNPVNDRRTTKGVFHIADYGLPIPADKIRVP
LVTYAKLLEASLKPPGELNKVPYTSKWKSPIESMVSLMLRPLVCPEVPGVSPEKRLEVRF
FVPGGCVSNLDFVESIFGNAGDPGLPENDAELDCQHWTGTSGCVILAPHLRGLKKKDLCL
PHVSEATEDQKATGMCWESEDELYNHGSPFKITLRDKRGIMVTILADNYFGYCKKEVKTQ
IGLAANIFGLAEEEHAGGAVAFKSYSLGTNFYPEEGHVGKNHSYLEALKLLGDTVTVHPE
GYATDKKFRNIHILPEDMEVDLNSQSATWMKDGEKQRLRVLPGHEYLHPSGYKIRLEKHA
ASTAYKLIGTAGEGTYCHKPATVSGGGKSEISKSLNDAVIYGAIFIGDYEKDMAIVKDIL
EHDYSNCFEPQYAPQRSPSRKILSMERSLGSVVKLLTPNKEYTKEHCEFICGIPSHIRSV
VFAIKRFYKPEWGDEWESHFSVDIVNGAPGHELKLDGRKLSGTYLRVGHDHVNGGWRTYK
LRQDFISADKVQMEDDITASVVVPRNQLKSLPDEYSMFPSVKISQNCEWRLFQRPDDAIY
PGFDKQTEEDFAGNHIFTSNFKPIYEEEMKDLTEQVDFYEVFTDPMKAHMKRCLKEGGVN
VCSAKPRIWHGQVTKNPRYLQVRPDVARPREKYLAELGTRLYRKIPSTDACVFPVAAVIS
GRRNNPPDVDINGVKIRPLCVFNPIHYQELPELFIDYVCSVTGKSPSTTGAGSEGALTKG
PFNAINATADLNNALVSMILTGYGGFSSAAGYIGPDYKVDHDISLLIPEVWCRMTPSERS
AECLIKNGELERLEDFDLDTAEGTKRVLASRLGYRITDKFVSHYFGRVFDNPAAAINDEM
LKPELQSLEVFADGIDNLVEAERKSALNYFKDDTIKYACPLLQIVLHIMAYGHYNNKSIH
DPEIRAMFTREAMLKSDWYKQRLVTKQNRDVLLSMRNIKALEDFMSRPGYSSESARLGIH
ERLKIAQNELARVSDDSYLKELEGTLGADPIVFDE
NT seq 3528 nt   +upstreamnt  +downstreamnt
atggctaacactaacctccacggagaagacctcatccgccactgtggtttgaacgacaat
gggaaggctgttgagcagatggatcctcactccttccatcgtttgatagccgtcaaacta
gcctcccagggcttcgaagtccctcaagcccgaaatggcaatgaagtagccgagaaccaa
gtccttcaactagcatccgacctctttcgtcgctatgctgaacagtcccgtctcctaact
ggtcatctcaatcctcccgatcgtcgtattcaagactttcttgatgatgcacttgcatca
acgggagtgaaggttgaactcccgacgaatgtcataaacatggatcggtatggaatggct
cgtaagctctctcttcctgacgatccaagtgccacggagtttcacaactcggaagtatca
agttacaacctatgcaatggagtgttgcacaatccagtgaacgatcgtcgtaccaccaag
ggagtcttccacattgcagactacggtcttcccattcctgcggacaagatccgtgttcct
ttggtaacctacgctaaacttttggaggcatcgttgaaacctcctggtgaattgaataaa
gttccatacacctccaaatggaagagtcctatcgagtccatggtgtcgttgatgcttcgt
cctctggtatgccccgaggtgcccggagtgagtccagagaagcgattggaggttcgtttc
ttcgtaccaggtgggtgtgtgtccaatcttgacttcgtggaaagtatctttggcaacgca
ggtgatccggggttgcctgagaatgatgctgagttggattgtcagcattggactggcact
tccggatgtgtgattcttgcacctcacctacgtggcttgaagaagaaggacttgtgtctc
ccacacgtcagcgaagctactgaggatcaaaaggcaacgggcatgtgctgggaatcagaa
gacgagctctacaaccatggatctcccttcaagattactctacgagataagcgtggaatc
atggtcactatactggccgacaactacttcggctattgtaagaaggaagtcaagactcag
attggattggctgccaacatctttggattggccgaggaggagcatgctgggggggccgtg
gcattcaagtcctattctttggggacgaacttttatcctgaagaaggacacgtcggcaag
aatcattcatatctcgaggcgttgaagctgcttggagatactgtgaccgtccatcctgaa
ggttatgccaccgataagaagtttaggaacatccacatccttcctgaggatatggaagtt
gatttgaactcacaatctgctacgtggatgaaggatggagagaagcagcgcctccgtgta
cttccaggacatgagtatctgcatccgtctgggtacaagatccgcttggagaagcatgct
gcctccactgcctacaagctcattggaacagctggagaggggacttactgccacaaacca
gcaactgtcagtggaggaggaaagagtgagatttcaaagagtctcaatgacgccgtgata
tatggggccattttcattggtgattatgaaaaggatatggcaatcgtcaaggacattctt
gagcatgactattccaactgctttgagccacaatatgctccacagcgcagtccaagtcgc
aagatattgtcgatggaacgctctctcggctcggtcgtgaagcttcttactcccaacaaa
gagtacaccaaagagcattgcgagttcatatgtggcatccccagtcacattcgctctgtc
gtctttgcaatcaaacgattctacaaacccgagtggggtgatgaatgggaaagtcatttc
tctgttgacattgtaaatggcgcccctggacatgagttgaagcttgacggaaggaagctc
agtggaacgtatctccgtgtcggtcatgaccatgtcaacggtggatggaggacgtacaaa
cttcgtcaggactttatttcagcggataaggtgcaaatggaggatgatatcacggcaagt
gtcgttgttcctcgcaatcaactcaagagtctgcctgatgaatactccatgtttccatca
gtcaagataagtcagaactgtgaatggaggctattccagcgaccggacgatgccatctat
cctggttttgataagcagactgaggaagactttgctggcaatcacatattcacctccaac
ttcaagccgatctacgaagaggagatgaaagacttgacggagcaagttgacttctatgaa
gtcttcactgacccaatgaaggcacacatgaaacgatgcctcaaagagggaggcgtaaac
gtctgttctgcgaaaccaaggatctggcacggtcaagtcaccaagaatcctcgttacctt
caggtgcgtcccgatgtagctagaccaagggaaaagtatttagctgagctcggtactcgg
ttgtaccgcaagatcccgtcgacagatgcatgtgttttccctgttgctgctgtcatctct
ggcagaaggaacaaccctccagacgttgatatcaacggcgttaagattaggccattgtgt
gtcttcaatcctattcactaccaagaacttcccgagctgttcatcgactacgtgtgctca
gtcactggcaaatcgccttcaaccactggtgctggctcggagggagctctcactaaaggc
ccattcaatgcaatcaatgccactgctgacttgaacaacgccttagtatcgatgatactc
accggttatggtggattttcgtccgcagcaggctatattggtcctgattataaagtagat
catgacatcagcttgctaattccagaggtgtggtgtaggatgactccttctgaacgatct
gcagaatgcctaatcaagaacggagagctcgagaggcttgaggatttcgacctggatact
gcagaaggaactaaacgagtattggcaagccgtcttggttatcgtatcactgacaagttc
gtgtctcattactttggacgtgtgtttgataaccctgcggctgctatcaacgacgagatg
ctcaagcctgagttgcaatctttggaagtatttgcggatggaattgacaatcttgtcgag
gctgagaggaaatcggccctcaactacttcaaggatgacactatcaagtatgcttgtcca
ctcctccagatcgttcttcacatcatggcatatgggcattacaacaacaagtctattcat
gatcccgagattcgtgccatgttcacacgagaggcaatgctcaagagtgactggtacaag
cagaggcttgtcacgaaacaaaatcgcgatgtgcttctttcgatgcgaaacattaaggca
ttggaagactttatgagccgcccaggctattcttccgagtctgctcgtctcggcattcac
gagcgcttgaagattgcacagaatgagcttgctcgtgtgagtgatgattcttatctgaag
gagttggagggtacattgggagctgatcctatcgtctttgacgagtag

DBGET integrated database retrieval system