KEGG   Trueperella pyogenes TP6375: CQ11_03555Help
Entry
CQ11_03555        CDS       T03070                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tpy  Trueperella pyogenes TP6375
Brite
KEGG Orthology (KO) [BR:tpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CQ11_03555
Enzymes [BR:tpy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CQ11_03555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Glutaredoxin Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 FAD_binding_3 Thi4 Thioredoxin_4 NAD_binding_8 DUF4115 Thioredoxin Lycopene_cycl AlaDh_PNT_C DAO
Motif
Other DBs
NCBI-ProteinID: AHU89213
LinkDB All DBs
Position
743405..744940
Genome map
AA seq 511 aa AA seqDB search
MLDANALAQVKQLLTNVKLPVVLEASLDASERSTKLRELLEEVAGQSELVSWREVPHPRT
PSFAITRAGTDVSVRFAGVPMGEEFASFMLALVQVGGHPVRADEAIVEQIMAIEDEHDFV
TYMSLTCQNCPTVVQTLNAMSILNPKIRHTAVEGSAFQDEVNELGIKAVPTIYRNGELFD
QGRRGFEEILAKITDSSAHLARLNEQAPFDLLIVGGGPAGSSAAIYAARKGLNVGVATHN
VGGQVLDTDSIANLGVIDMIRGTELGNQLASNMSSYGVNVMRNLRATKLHRPDAASPLVV
DFEGGVSLRAKSVLIATGARFRTTGVPGEEEYRNRGVSFCPHCDGPLFAGKPLAVLGGGN
SAIEAAIDLAGIASHVTVLEFTPHLNADKILVDKLDELKNTTVITSAALESIRGDGEEMT
GLTYRNADGVATDLEVNGIFIQIGLVPNAEWLEGTLDMNRGSVVIDADNATSMEGVFAAG
DVTDIPHKQIVIALGAGANASLSAFNYLIRN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgccaacgcgctggctcaagtcaagcaactgctgacaaacgtcaagcttccc
gtcgttctcgaggcatcgctagacgcttcggagcgctcaacgaagctgcgtgagctgttg
gaagaggtcgccggccaaagtgagcttgtctcctggcgcgaggttccacacccacgcacg
ccctcattcgccatcacgcgcgcggggacggatgtttccgtgcgtttcgcgggcgttccc
atgggcgaggagttcgcaagtttcatgctggcactcgtccaggtaggcggacatccagtg
cgggccgacgaggcgatcgtcgagcagatcatggccatcgaggacgaacacgacttcgtc
acctacatgtcgctgacgtgtcagaactgccccactgtggttcagacgttgaatgcgatg
tcgatccttaacccgaagatccggcacaccgctgtagaaggaagtgctttccaggacgag
gtcaacgagctcggcatcaaagccgtccccacgatctaccgaaacggtgagctctttgac
cagggtcggcgcggtttcgaggaaatcctggcgaaaatcaccgattcctctgcccattta
gcacggctcaacgagcaggcccccttcgatctcctcattgtaggtggtggcccggcaggc
tccagcgccgcgatttatgccgcacgcaaggggctcaatgttggcgtcgcaacgcacaat
gtcggaggccaggtactcgatacggattctatcgcgaacctcggcgtcatcgacatgatt
cgtggtacggagttgggcaaccagcttgcgtccaatatgtcatcgtatggcgtgaacgtc
atgcgcaacttgcgtgcgaccaagttgcaccgcccggatgccgcctcgccgctcgtcgtc
gatttcgagggcggggtcagccttcgagccaagtccgtcctcatcgcgacgggcgcccgc
ttccgcaccactggagtgcccggcgaggaggagtaccgcaaccgcggagtctccttctgt
ccgcactgcgacggcccgctcttcgctggcaaaccgctcgcggtgctcggcggtggcaac
tcggcgatcgaggccgcgatcgacctcgcaggcatagccagtcacgtgaccgtcctcgaa
ttcaccccgcacctgaacgcggacaagatcctcgtggacaagctcgacgagctcaagaac
accaccgtcatcacctcggccgcgctcgaatcgatccgcggcgacggcgaggaaatgacc
gggctgacatatcgcaacgccgacggcgtcgctaccgacctcgaggtcaacggcatcttc
atccaaatcggcctcgttccgaacgccgaatggctcgaaggcaccctcgacatgaaccgt
ggctcggtcgtcatcgacgccgataacgccacctccatggaaggtgtgttcgcagccggt
gatgtcaccgacattccgcataagcagattgtcatcgccctcggcgcgggcgccaacgcc
tcgttgagcgccttcaactacctcatccgcaactag

DBGET integrated database retrieval system