KEGG   Takifugu rubripes (torafugu): 101077364Help
Entry
101077364         CDS       T02386                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00500  Starch and sucrose metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101077364
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101077364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101077364
NCBI-ProteinID: XP_003975447
LinkDB All DBs
Position
22
AA seq 512 aa AA seqDB search
MKFLILVALFGLGFAQHNPHLQHGRTSIVHLFEWRWADIAAECERFLGPNGFGGVQISPP
NEHIVLNSPWRPWWQRYQPISYNLCSRSGSENELRDMITRCNNVGVNIYVDAVINHMCGA
GGGEGTHSSCGSWFSAGRKDFPSVPFSNMDFNDHKCRTGSGNIENYGDANQVRDCRLVGL
LDLALEKDYVRGKVADYMNKLINMGVAGFRVDACKHMWPGDLSAIYDRLHNLNTKWFPNG
SRPFIFQEVIDLGGEPITSREYFHLGRVTEFKYGAKLGTVFRKWNNEKLMYTKNWGEGWG
FMSNGNALVFVDNHDNQRGHGAGGASIVTFWDARLHKMAVGYMLAHPYGVTRVMSSFRWN
RHIVNGKDQNDWMGPPSHPDGSTKSVPINPDETCGDGWVCEHRWRQIKNMVIFRNVVNGQ
PHSNWWDNNSNQVAFGRGNRGFIVFNNDDWDLDVTLNTGMPGGTYCDVISGQKEGGRCTG
KQIHVGGDGRAHFKISNRDEDTFVAIHAESKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctcattctggtggctttgtttgggctcggcttcgcccagcacaacccccac
ctccaacatgggaggacctccattgtccacttgtttgagtggcgctgggcagacatcgct
gctgagtgtgagcgcttcttgggtcccaatggctttggtggagttcagatttcccctccc
aatgagcacatagttcttaacagcccgtggaggccctggtggcagagataccagccaatc
agctacaacttgtgctccagatctggaagtgagaatgagctgagagacatgatcaccaga
tgcaacaatgttggggtcaacatctacgtggatgctgtcatcaaccacatgtgtggtgca
ggtggcggtgagggaacacactcctcatgtggcagctggttcagtgcaggcaggaaagac
ttcccctctgtcccattttccaacatggacttcaatgatcacaaatgtagaactggaagt
ggaaatattgaaaactacggcgatgctaatcaggtacgtgactgtcgtctggttggtctc
ctggatctcgccctggagaaagattacgtgagaggtaaggtggctgactacatgaacaag
cttatcaacatgggtgtggctggattcagagtggatgcctgcaaacacatgtggcccggt
gacctgtctgccatctacgatcgactgcacaacctaaacaccaagtggttccccaacgga
tcaaggcctttcatcttccaggaggttattgacctgggaggtgagcctattacctccaga
gagtacttccatctgggcagggtgactgagtttaaatatggtgccaaactgggaactgtc
ttcagaaaatggaataatgaaaagttgatgtacaccaagaactggggagagggttggggt
ttcatgtctaatggcaatgctcttgtcttcgttgacaaccatgacaaccagagaggacat
ggtgctggtggagcatctattgttaccttctgggatgccaggctccacaagatggctgta
gggtacatgctggctcacccatatggagtaaccagggtgatgtcaagcttccgttggaac
cgccacattgtcaatggaaaggaccagaatgactggatgggccctcccagccaccctgat
ggatcaaccaaatctgttcccatcaacccagatgagacttgtggtgatggatgggtgtgt
gagcacagatggcgtcagatcaagaacatggtgattttccgcaatgttgtcaatggacaa
cctcattccaactggtgggataataacagcaaccaggttgcctttggacgtggtaatcgt
ggtttcatcgtctttaacaatgatgattgggacctggatgtgacccttaacacaggcatg
cctggtggcacctattgtgatgtcatttctggccagaaagagggtggccggtgtactggc
aagcagatccacgtgggtggtgatggtcgtgcacacttcaagattagcaacagggatgaa
gacacttttgttgctattcatgctgaatccaagctgtag

DBGET integrated database retrieval system