KEGG   Takifugu rubripes (torafugu): 101078708Help
Entry
101078708         CDS       T02386                                 

Gene name
plcb4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00562  Inositol phosphate metabolism
tru01100  Metabolic pathways
tru04020  Calcium signaling pathway
tru04070  Phosphatidylinositol signaling system
tru04261  Adrenergic signaling in cardiomyocytes
tru04270  Vascular smooth muscle contraction
tru04310  Wnt signaling pathway
tru04371  Apelin signaling pathway
tru04540  Gap junction
tru04621  NOD-like receptor signaling pathway
tru04912  GnRH signaling pathway
tru04916  Melanogenesis
tru04933  AGE-RAGE signaling pathway in diabetic complications
Module
tru_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101078708 (plcb4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101078708 (plcb4)
   04371 Apelin signaling pathway
    101078708 (plcb4)
   04020 Calcium signaling pathway
    101078708 (plcb4)
   04070 Phosphatidylinositol signaling system
    101078708 (plcb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101078708 (plcb4)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101078708 (plcb4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101078708 (plcb4)
   04916 Melanogenesis
    101078708 (plcb4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101078708 (plcb4)
   04270 Vascular smooth muscle contraction
    101078708 (plcb4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101078708 (plcb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tru04131]
    101078708 (plcb4)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101078708 (plcb4)
Membrane trafficking [BR:tru04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101078708 (plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101078708 (plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y PH_14 DUF1154 EF-hand_like C2 PLC-beta_C EF-hand_6
Motif
Other DBs
NCBI-GeneID: 101078708
NCBI-ProteinID: XP_003971635
Ensembl: ENSTRUG00000009253
UniProt: H2TF26
LinkDB All DBs
Position
16
AA seq 1232 aa AA seqDB search
MTKSYEFNWQKHLPEFMQDGASFDRFDEDPYMFEPSCHMKVDEYGFFITWKSEGKEGQVL
ECSLINSIRVGAVPKDPKILSSFEAIGKTEADLEGCIICICSGTDLVNINFMFMVAENPE
TARKWIEGLRSVIHNFKANNVCPMTCLKKHWMRMCFSTNVNGKIPVRGITRTFASGKTEK
GIFQALKDLGLPSGKNDEIEQSDFTFDIFYALTQKICPRTDIEELFKKINGNKTDYLTVD
QLVSFLNENQRDPRLNEILFPFYDNKRAMQIIEKYERDAELKKKGQMSSDGFCRYLMSDE
NAPVFLDRLELYQEMDQPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLSGSRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSDYPVILSFENHCSKPQQYKM
AKYCEEIFGELLLKQPLENFPIESGRPLPSPNDLKRKILIKNKRLKPEVEQKQLEAFKKH
MEAGETNTSAIIMGEENEDETENGEKEAEDKDVNSEAPSSLSEATSDKESNSVKSKKDEE
RNNSIKKVPEDEVTEMSEATDATDISEASDQDNNKKGGEEEEESEEALIAQYTYVGATTN
IHPWLSAMVNYAQPVKFQSFDVAEERNIHHNMSSFNESVGLGYLKTNAIEFVNYNKRQMS
RIYPKGGRVDSSNYMPQIFWNAGCQMVSLNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFM
RRSDRMFDPFSETPVDGVIAAHCSVQVFSGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRT
RMVMNNGLNPAYNEEPFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHIS
LRNEGNKPLSLPTIFCQIILKTYVPDGFGAIVDALSDPKKFLTIAEKRADQMKALGIDTT
DIADVPSGSSKGDKKGKGKGETVKASVTPQASSDMAQTSNATQNNIAETKKDPALVPNVS
IDDLKQMKTYLKLLKKQQKELGALKKKQSKEQNTMQKAHCTQVDKMVSQHDKEKMVLEKL
LEKAIKKRGENNCQELKKETEDKIQTLVTDHKAKVKDITAQHTKEWSDLISSQSNEEQEM
KDSHVTQQCDHLKKLLATVQEQQTMQLKLIQERQSKEMRANQAKISMENSKAISQDKSIK
NKAERERRVRELNSSNTKKFLDERKRLAMKHQKEMEQLEKNQREQLEKLEKFNEQLLKSH
HANKLVQGQGHAADGEVGGGDGPQTCHSGVKD
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcttacgagttcaactggcagaagcacctgcctgagttcatgcaggatggc
gcctccttcgacaggtttgatgaggacccgtacatgtttgagcccagctgccatatgaag
gtggatgagtatggctttttcatcacgtggaagagtgagggaaaggagggccaggttctt
gagtgttctctcatcaacagtatccgtgttggcgccgtcccaaaggaccccaagattttg
tcttcattcgaggccattgggaagacagaggcagatttagagggctgcatcatctgcatc
tgcagcggcacagacctggtcaacatcaacttcatgttcatggtggcagaaaatccagag
actgccaggaaatggatcgagggtttgaggtcagtgattcacaactttaaggccaacaac
gtctgtccaatgacctgcctcaagaaacactggatgagaatgtgtttctcaaccaatgtg
aatgggaagattcctgtgagaggcatcacgcgaacatttgcatcaggaaaaacagagaag
gggatctttcaggccctaaaggaccttggccttcccagtggaaagaatgacgagatcgaa
caatcagattttacctttgacattttctacgcgctcacacagaagatctgccctcgcaca
gatatagaggaattattcaagaagatcaatgggaacaaaactgattatttaactgtagac
cagttagtcagctttctgaatgaaaaccagcgtgaccccaggttaaatgagatactcttc
ccattctatgacaacaagagagccatgcagatcatcgagaaatacgaaagagacgctgaa
ctgaagaagaaaggtcagatgtccagcgatggcttttgcagatacttgatgtctgatgag
aatgcacctgtgttcctggatcggctggagctctaccaggagatggaccagccactggcc
cactacttcatcagctcctcccacaacacttacctgaccgggcgtcagtttggagggaag
tcatcagtggagatgtatcgtcaggtgctgctgtctggatccaggtgcgtagagctggat
tgctgggatggaaaaggagaggaccaggagcccattatcactcatggcaaggccatgtgc
acggacatcctgttcaaggatgttatccaggccattaaagagacagcatttgtcacttca
gattaccctgttattttgtcctttgaaaaccactgcagtaaaccacagcagtacaagatg
gccaaatactgtgaggagatatttggggaactactgctaaagcagcccctggaaaacttc
ccgattgaatctggccgcccgttaccctctccaaatgatctgaaacgcaaaatcctcatc
aagaacaagagattgaaacctgaagttgagcagaaacagttggaggcctttaagaaacac
atggaggcaggggagactaacacttctgcaattattatgggtgaagaaaatgaagatgag
acagagaacggagagaaggaggccgaggataaggacgtgaattcagaggctcctagtagt
ctgtctgaggcaactagtgacaaggagtccaacagcgtcaagtcaaaaaaagatgaagaa
cgcaacaacagtatcaagaaggttcctgaagatgaagtgacagaaatgtctgaagcaaca
gatgccacagatatctcagaagcatcagaccaagacaataacaaaaagggtggggaggag
gaggaagaatcggaagaggctctcatagctcagtacacctacgtaggtgccaccactaat
atccacccatggctctccgccatggtcaactacgcacagccagtaaagttccagagcttt
gatgtggcagaggaaaggaacatccaccataacatgtcatcctttaatgagtctgttggc
ctgggctatctgaagaccaatgccatcgaatttgtcaactacaacaaacgtcagatgagc
cgtatctaccccaaagggggccgcgtggactccagtaattacatgcctcagatcttctgg
aacgccggttgccagatggtctctctcaacttccagaccccagatctggccatgcagctg
aaccaggggaagtttgagtacaacggctcctgcggctatctgctaaagcccgactttatg
agacgctcagacaggatgtttgaccctttctcggagacgccggtcgatggcgtcattgct
gcacactgcagtgttcaggtcttctctggacagttcttgtcggacaaaaaaattggcaca
tatgtagaggtggacatgtacgggctaccgacagacaccatccgcaaggagttccgcaca
cgtatggtgatgaacaatgggctaaaccctgcgtacaacgaagagcccttcgtgtttaga
aaggtaattttaccagatctggcggttctgcgcattgctgtgtacgatgataacaacaag
ctgattgggcaacgcatcctgcccctggacggcctgcaggctggctaccggcacatttca
ctgaggaatgaagggaacaagcccctctcattgcccaccattttctgccagatcatcctt
aagacctacgtgcccgacggctttggcgctattgttgatgccctctcagatccaaagaag
ttcttaactattgcagagaagagagctgaccagatgaaggccctggggattgacacgact
gatatcgcagacgttcccagtggaagctcaaagggtgacaaaaagggaaaggggaaagga
gaaacggtgaaggccagtgtgacaccacaggccagctcagacatggctcagacctccaac
gccacccaaaacaacatagcagaaacaaagaaggatcctgccctcgtgcctaatgtcagc
atcgatgacttaaaacaaatgaagacataccttaaactgctaaaaaagcaacagaaggaa
cttggtgctttaaagaagaaacagtcaaaggaacaaaatacaatgcagaaagctcactgc
acccaggtggacaagatggtgtcgcagcatgacaaggaaaagatggttttggagaaacta
ctagagaaggccatcaagaaacgaggggaaaataactgccaagagttaaagaaagaaaca
gaggataaaatccaaacactggtcacagaccacaaagccaaggtaaaggacatcactgcg
cagcacactaaagagtggtcagatctcatcagcagccaaagcaatgaggagcaggaaatg
aaggacagccatgtgacacagcagtgtgatcacctaaagaagctcctggccaccgtgcag
gagcagcagaccatgcagctcaagctcatccaggaacgacagagcaaagaaatgcgagcc
aaccaggccaagatatccatggaaaacagcaaagccatcagccaggacaagagcataaaa
aacaaggcagagagagagaggagagtaagagagttaaatagcagcaacaccaagaagttc
ctggatgaaagaaaaaggctggccatgaagcatcagaaggaaatggagcaactggagaaa
aaccagagagaacagttagagaaactggagaagttcaatgagcagcttttgaaatcacac
catgcaaacaaactggttcaaggccaaggacatgcagcagatggtgaagttggaggagga
gatggaccgcagacctgccacagtggtgtgaaagactga

DBGET integrated database retrieval system