KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0265
Entry
Ththe16_0265      CDS       T01867                                 

Definition
(GenBank) GTP-binding protein Era-like-protein
  KO
K03595  GTPase
Organism
tts  Thermus thermophilus SG0.5JP17-16
Brite
KEGG Orthology (KO) [BR:tts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tts03009]
    Ththe16_0265
   03029 Mitochondrial biogenesis [BR:tts03029]
    Ththe16_0265
Ribosome biogenesis [BR:tts03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Ththe16_0265
 Prokaryotic type
  GTPases
   Ththe16_0265
Mitochondrial biogenesis [BR:tts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ththe16_0265
SSDB
Motif
Pfam: MMR_HSR1 KH_2 Dynamin_N FeoB_N AIG1 RsgA_GTPase GTP_EFTU cobW Ras Roc AAA_22 AAA_18 ABC_tran SRPRB NTPase_P4
Other DBs
NCBI-ProteinID: AEG32696
UniProt: F6DD69
LinkDB
Structure
PDB: 
1WF3

Position
247378..248283
AA seq 301 aa
MAEKTYSGFVAIVGKPNVGKSTLLNNLLGVKVAPISPRPQTTRKRLRGILTEGRRQIVFV
DTPGLHKPMDALGEFMDQEVYEALADVNAVVWVVDLRHPPTPEDELVARALKPLVGKVPI
LLVGNKLDAAKYPEEAMKAYHELLPEAEPRMLSALDERQVAELKADLLALMPEGPFFYPE
DYAKSDQTFGEWVAEILREEAMKRLWHEVPYAVATKVEEVAERENGVLYIKAILYVERPS
QKAIVIGEGGRKIKEIGQATRKQLEALLGKKVYLDLEVKVYPDWRKDPEALRELGYRSSV
G
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcggaaaagacctattccggatttgtggccatcgtgggcaagcccaacgtgggcaag
tccaccctgctcaacaacctcctcggggtgaaggtggcccccataagcccccgcccccag
accacccgcaagcgcctccgcgggatcctcaccgagggaaggcggcagatcgtcttcgtg
gacaccccggggctgcacaagcccatggacgccctgggggagttcatggaccaggaggtg
tacgaggccctcgccgacgtgaacgccgtggtctgggtggtggacctgcgccaccccccg
accccggaggacgagctggtggcccgggcgctcaagcccctcgtggggaaggtgcccatc
ctcctcgtggggaacaagctggacgccgccaagtatcccgaggaggcgatgaaggcctac
cacgagcttttgcccgaggccgagccgcggatgctctccgccctagacgaaaggcaggtg
gccgagctcaaggcggaccttctcgccctcatgccggaaggccccttcttctacccggag
gattacgccaaaagcgaccagaccttcggggaatgggtggcggagatcctccgggaggag
gccatgaagcgcctctggcacgaggtgccctacgccgtggccaccaaggtggaggaggtg
gcggaaagggagaacggcgtgctctacatcaaggccatcctctacgtggagcgcccctcc
cagaaggccatcgtcatcggcgagggcgggcggaagatcaaggagatcggtcaggccacg
aggaagcagctcgaggccctcctcggcaagaaggtgtacctggacctcgaggtcaaggtc
taccccgactggcgcaaggaccctgaggcccttcgggaactcggctaccgttcctccgta
gggtga

DBGET integrated database retrieval system