KEGG   Teredinibacter turnerae: TERTU_1259
Entry
TERTU_1259        CDS       T00952                                 

Definition
(GenBank) carbazole dioxygenase-like protein
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00621  Dioxin degradation
ttu01100  Metabolic pathways
ttu01120  Microbial metabolism in diverse environments
ttu01220  Degradation of aromatic compounds
Module
ttu_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    TERTU_1259
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     TERTU_1259
SSDB
Motif
Pfam: Aromatic_hydrox Rieske
Other DBs
NCBI-ProteinID: ACR14176
UniProt: C5BRU7
LinkDB
Position
1316280..1317452
AA seq 390 aa
MSDEHDTPEGVNEEVVKMVGDWGGYVEAKLGFRNHWYPVRFSKELAEGEILTVTVLGEQM
IMRRIDGKVYAIRDRCLHRGVPLSRKPDCYTKDTITCWYHGYTYRFQTGELVNILAAPDS
RLIGKRKIQSFPVEEAQGLIFVFIGDMSPTPPLSQDVPPGFLDEDLMVLGKHRDVNSNWR
LGAENGFDTLHIFIHKDTTLRHYRDFNFPIGHTALPGAITLVEDPEGPKGVEDDFSKHNP
IWDGLIDGNVVIRGPRSNNVEGTSASVGTSIWLPGVLKVNSFPAPGLTQFEWYVPIDESR
HIYVQTIGCKVETEEDRIDFAHNFETTWKPHGLDGFNGDDIWAREVTEPFYQDDYGWVDE
MLCEPDSSILAWRRLASRANRGIQKRKDLR
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagtgatgagcacgatacgccggaaggtgtcaacgaagaagtggtaaaaatggtcggc
gattggggtggctatgtggaagcgaaactgggttttcgcaaccattggtatccggtgcga
ttctctaaagagctggcggaaggtgaaatactgacagtgaccgtactgggcgagcaaatg
atcatgcgtcgcatcgacggcaaagtctatgcaattcgcgatcgatgcctgcaccgcgga
gttccgctttcccgcaagccggactgctacaccaaagataccattacttgctggtaccac
ggttatacctaccgtttccagacgggcgaactggtgaatattctcgctgcacctgacagc
cgcttaattggtaagcgaaaaattcagagctttcctgtggaagaagcccagggtttgatt
tttgttttcatcggcgatatgtcgccgacgccgcctttatcccaggatgtaccaccgggt
tttctcgatgaagatttgatggtgctgggtaaacatcgcgacgttaattccaattggcgc
ctgggagctgaaaacggtttcgatacgctgcatatttttattcacaaagataccaccttg
cgacactaccgcgactttaacttcccaatcggtcacacggctttgcctggcgcgattacc
ttggtggaagatcccgaggggccaaagggcgtggaggatgatttttccaaacacaacccg
atatgggatggcttgattgatggcaacgtggttatccgcggtccgcgctcgaataacgtg
gaaggcacttccgcatcggtgggaacctctatttggcttccgggtgtattgaaggtgaat
tcttttcctgctcccggcttaacgcaatttgagtggtatgtgcctattgatgagtcccga
catatttatgtgcagactatcggttgcaaagtggaaaccgaggaagaccgcatcgatttt
gcccacaatttcgaaacgacctggaaaccccacggccttgatggattcaatggcgatgat
atttgggcgcgggaagtgaccgagccgttttatcaggacgactatggttgggtggacgaa
atgttatgtgagcccgacagtagtattttagcctggcgtcgtttggcgagtcgtgcaaac
cgcggtattcaaaagcgcaaagacttgcgttga

DBGET integrated database retrieval system