KEGG   Tupaia chinensis (Chinese tree shrew): 102476506
Entry
102476506         CDS       T02978                                 

Gene name
CCKAR
Definition
(RefSeq) cholecystokinin A receptor
  KO
K04194  cholecystokinin A receptor
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04080  Neuroactive ligand-receptor interaction
tup04911  Insulin secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102476506 (CCKAR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102476506 (CCKAR)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102476506 (CCKAR)
  09154 Digestive system
   04972 Pancreatic secretion
    102476506 (CCKAR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tup04030]
    102476506 (CCKAR)
G protein-coupled receptors [BR:tup04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    102476506 (CCKAR)
SSDB
Motif
Pfam: 7tm_1 CholecysA-Rec_N 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 102476506
NCBI-ProteinID: XP_006155011
UniProt: L9KFJ4
LinkDB
Position
Un
AA seq 585 aa
MDVVDSLLVNGSNITLPCELRLENETFFCLDQPNPSKEWQPAVQISLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPYTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDASQKKSVKERKASTGSSGRPEDSDGCYLQRPRGRLELQQLSGRPGRIRSSSSAANLA
AKKRVVRMLIVIVVLFFLCWMPIFSANAWRAYDPGSAERRLSGTPISFILLLSYSSACVN
PIIYSTTAGPRARPCRATPTATWAARLRPERAADQRGRGGKEVRQTPEAEVKDREAPLPG
ELCRACFPAFARRLQGRARVAPWPGFEVVQVMSGVLGRPGTAFAGVTLHTALLSSARNGA
VDLIELEGSRTSRMGCHSCDDRVPCCFCTSSCVEAASPWGAVTHACTQGSHLIGAQERAP
SQPSLGILCVRRKPNFLVKHIHRHEHMSSSESHKDRKDREREFGT
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggacgtggttgacagccttcttgtgaatggaagcaacatcactcttccctgtgaactc
aggctcgagaatgagacgtttttctgcttggatcagcccaatccttccaaagagtggcag
ccggccgtgcagatctccctgtactccttgatatttctgctcagcgtgctgggcaacacg
ctggtcatcacggtgctgattcggaacaagaggatgaggaccgtcaccaacatcttcctg
ctctcgctggccgtcagcgacctcatgctctgcctcttctgcatgccgttcaaccttatc
cccaacctgctcaaggatttcatcttcgggagtgccgtctgcaagaccaccacctacttc
atgggcacctctgtgagtgtatccacctttaatctggtggccatatctctggagagatac
ggcgcgatttgcaaacctttacagtcccgggtctggcaaacaaaatcccacgctctgaag
gtgatcgctgctacctggtgcctctccttcaccatcatgacgccttaccccatttatagc
aacctggtgccttacaccaaaaacaacaaccagaccgcaaatatgtgccgctttctactg
ccgaatgatgttatgcagcagtcttggcacacgttcctgttactcattctctttctcatt
cctggaattgtgatgatggtggcatatggactaatctctttggaactctaccaaggaata
aagtttgatgctagccagaagaaatctgttaaagagaggaaagcgagcacgggcagcagc
ggcaggccggaggacagcgacggctgctacctgcagaggccgcgcgggcggctggagctg
cagcagctgtcgggcaggccgggccgcatccgcagcagcagctcggcggccaacctggcg
gccaagaagcgcgtggtgcgcatgctcatcgtcatcgtggtgctcttcttcctgtgctgg
atgcccatcttcagcgccaacgcctggcgggcctacgaccccggctcggccgagcgccgc
ctgtcggggacgcccatctccttcatcctgctgctgtcctacagctcggcctgcgtcaac
cccatcatctactcgacgacggccggaccacgggcgcgtccctgtcgcgctactcctaca
gccacgtgggctgcgcgcctgcgccctgagcgcgctgcagaccagcggggccgaggcggg
aaagaggtaaggcagacaccggaagcggaagtgaaggaccgggaggcgccacttccgggg
gagctctgcagggcctgctttccagccttcgcccggcgcctgcaggggcgtgcgagggtg
gccccgtggccgggcttcgaggtggttcaggtcatgtcgggagtcctaggcaggcccggg
acagcgtttgcaggagtcactctgcacacggcactgctgagcagtgctcgaaacggggcc
gtggaccttattgagctagaaggttctagaacatcccggatgggctgtcactcctgtgat
gacagagtgccctgctgcttttgcacgagcagctgcgtggaggctgcctctccttgggga
gccgtcactcatgcatgcacacagggcagccacctgatcggagcccaggagcgagccccc
agccaaccctctctgggcatcttgtgtgtgagaagaaagcccaattttttggtcaagcac
attcacagacatgagcatatgtcgtcttcagaatctcataaggacagaaaagaccgagag
agagaatttggaacttga

DBGET integrated database retrieval system