Tupaia chinensis (Chinese tree shrew): 102480869 Help Entry 102480869         CDS       T02978                                  Symbol RPA3 Name (RefSeq) replication protein A3   KO K10740   replication factor A3 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03030   DNA replication tup03420   Nucleotide excision repair tup03430   Mismatch repair tup03440   Homologous recombination tup03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102480869 (RPA3)    03420 Nucleotide excision repair     102480869 (RPA3)    03430 Mismatch repair     102480869 (RPA3)    03440 Homologous recombination     102480869 (RPA3)    03460 Fanconi anemia pathway     102480869 (RPA3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tup03032]     102480869 (RPA3)    03400 DNA repair and recombination proteins [BR:tup03400]     102480869 (RPA3) DNA replication proteins [BR:tup03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     102480869 (RPA3) DNA repair and recombination proteins [BR:tup03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      102480869 (RPA3)    MMR (mismatch excision repair)      102480869 (RPA3)   DSBR (double strand breaks repair)    HR (homologous recombination)      102480869 (RPA3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 DUF356 Motif Other DBs NCBI-GeneID:  102480869 NCBI-ProteinID:  XP_006170694 LinkDB All DBs Position Un AA seq 121 aa AA seqDB search MADVMELPRSRVNASMLAQFIDRPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLN EEISGIIEVIGRVTAKATIMCTSYIQFKEDSSPFDLGLYNEAVKITHEFPQFFPLGILQH D NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcggacgtcatggagctgcccagatctcgcgtcaacgctagtatgctagcacagttc atcgaccggcccgtctgcttcgtggggaggctggaaaagattcatcccactggaaaaatg tttattctttcagatggagaaggaaaaaatggaaccattgagttgatggaacctcttaat gaagaaatttctggtattatagaagtaattggaagagtaacagccaaggcaaccatcatg tgtacatcttatatccagtttaaagaagatagcagtccttttgatcttggactttacaat gaagctgtgaaaattacccatgagttcccccagttttttcctttaggtattctgcaacat gattga

DBGET integrated database retrieval system