Tupaia chinensis (Chinese tree shrew): 102493041 Help Entry 102493041         CDS       T02978                                  Symbol CALM3, Calmodulin Name (RefSeq) calmodulin 3   KO K02183   calmodulin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04020   Calcium signaling pathway tup04022   cGMP-PKG signaling pathway tup04024   cAMP signaling pathway tup04070   Phosphatidylinositol signaling system tup04114   Oocyte meiosis tup04218   Cellular senescence tup04261   Adrenergic signaling in cardiomyocytes tup04270   Vascular smooth muscle contraction tup04371   Apelin signaling pathway tup04625   C-type lectin receptor signaling pathway tup04713   Circadian entrainment tup04720   Long-term potentiation tup04722   Neurotrophin signaling pathway tup04728   Dopaminergic synapse tup04740   Olfactory transduction tup04744   Phototransduction tup04750   Inflammatory mediator regulation of TRP channels tup04910   Insulin signaling pathway tup04912   GnRH signaling pathway tup04915   Estrogen signaling pathway tup04916   Melanogenesis tup04921   Oxytocin signaling pathway tup04922   Glucagon signaling pathway tup04924   Renin secretion tup04925   Aldosterone synthesis and secretion tup04970   Salivary secretion tup04971   Gastric acid secretion tup05010   Alzheimer disease tup05012   Parkinson disease tup05022   Pathways of neurodegeneration - multiple diseases tup05031   Amphetamine addiction tup05034   Alcoholism tup05133   Pertussis tup05152   Tuberculosis tup05163   Human cytomegalovirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05214   Glioma tup05417   Lipid and atherosclerosis tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102493041 (CALM3)    04015 Rap1 signaling pathway     102493041 (CALM3)    04371 Apelin signaling pathway     102493041 (CALM3)    04020 Calcium signaling pathway     102493041 (CALM3)    04070 Phosphatidylinositol signaling system     102493041 (CALM3)    04024 cAMP signaling pathway     102493041 (CALM3)    04022 cGMP-PKG signaling pathway     102493041 (CALM3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102493041 (CALM3)    04218 Cellular senescence     102493041 (CALM3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102493041 (CALM3)   09152 Endocrine system    04910 Insulin signaling pathway     102493041 (CALM3)    04922 Glucagon signaling pathway     102493041 (CALM3)    04912 GnRH signaling pathway     102493041 (CALM3)    04915 Estrogen signaling pathway     102493041 (CALM3)    04921 Oxytocin signaling pathway     102493041 (CALM3)    04916 Melanogenesis     102493041 (CALM3)    04924 Renin secretion     102493041 (CALM3)    04925 Aldosterone synthesis and secretion     102493041 (CALM3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102493041 (CALM3)    04270 Vascular smooth muscle contraction     102493041 (CALM3)   09154 Digestive system    04970 Salivary secretion     102493041 (CALM3)    04971 Gastric acid secretion     102493041 (CALM3)   09156 Nervous system    04728 Dopaminergic synapse     102493041 (CALM3)    04720 Long-term potentiation     102493041 (CALM3)    04722 Neurotrophin signaling pathway     102493041 (CALM3)   09157 Sensory system    04744 Phototransduction     102493041 (CALM3)    04740 Olfactory transduction     102493041 (CALM3)    04750 Inflammatory mediator regulation of TRP channels     102493041 (CALM3)   09159 Environmental adaptation    04713 Circadian entrainment     102493041 (CALM3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102493041 (CALM3)   09162 Cancer: specific types    05214 Glioma     102493041 (CALM3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102493041 (CALM3)    05163 Human cytomegalovirus infection     102493041 (CALM3)    05167 Kaposi sarcoma-associated herpesvirus infection     102493041 (CALM3)   09171 Infectious disease: bacterial    05133 Pertussis     102493041 (CALM3)    05152 Tuberculosis     102493041 (CALM3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102493041 (CALM3)    05012 Parkinson disease     102493041 (CALM3)    05022 Pathways of neurodegeneration - multiple diseases     102493041 (CALM3)   09165 Substance dependence    05031 Amphetamine addiction     102493041 (CALM3)    05034 Alcoholism     102493041 (CALM3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102493041 (CALM3)    05418 Fluid shear stress and atherosclerosis     102493041 (CALM3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tup01009]     102493041 (CALM3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102493041 (CALM3)    03036 Chromosome and associated proteins [BR:tup03036]     102493041 (CALM3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102493041 (CALM3) Protein phosphatases and associated proteins [BR:tup01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102493041 (CALM3) Membrane trafficking [BR:tup04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102493041 (CALM3) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102493041 (CALM3) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102493041 (CALM3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 EFhand_Ca_insen EF-hand_11 UPF0154 SPARC_Ca_bdg DUF1103 DUF5580_M Dockerin_1 Poly_export SurA_N_2 SurA_N_3 Motif Other DBs NCBI-GeneID:  102493041 NCBI-ProteinID:  XP_006142163 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD GNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagatccctgggacagaaccccactgaagcggagctgcaggacatgatcaacgaggtg gatgcggatgggaacgggaccattgacttcccggagttcctgaccatgatggcccgaaag atgaaggacacggacagcgaggaggagatccgagaggcgttccgcgtctttgacaaggac gggaacggctacatcagcgccgcggagctgcgtcacgtcatgacgaacctgggggagaag ctgacggacgaggaggtggacgagatgatcagagaggccgacatcgatggggacggccag gtcaactatgaagagttcgtacagatgatgaccgccaagtga

DBGET integrated database retrieval system