KEGG   Tupaia chinensis (Chinese tree shrew): 102494008
Entry
102494008         CDS       T02978                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04310  Wnt signaling pathway
tup04350  TGF-beta signaling pathway
tup04371  Apelin signaling pathway
tup04390  Hippo signaling pathway
tup04520  Adherens junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04659  Th17 cell differentiation
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05161  Hepatitis B
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05220  Chronic myeloid leukemia
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102494008 (SMAD4)
   04350 TGF-beta signaling pathway
    102494008 (SMAD4)
   04390 Hippo signaling pathway
    102494008 (SMAD4)
   04371 Apelin signaling pathway
    102494008 (SMAD4)
   04068 FoxO signaling pathway
    102494008 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102494008 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102494008 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    102494008 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102494008 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102494008 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102494008 (SMAD4)
   05212 Pancreatic cancer
    102494008 (SMAD4)
   05225 Hepatocellular carcinoma
    102494008 (SMAD4)
   05226 Gastric cancer
    102494008 (SMAD4)
   05220 Chronic myeloid leukemia
    102494008 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102494008 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102494008 (SMAD4)
   05161 Hepatitis B
    102494008 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1
Other DBs
NCBI-GeneID: 102494008
NCBI-ProteinID: XP_006158457
LinkDB
Position
Un
AA seq 553 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSTAPNMLVKDEYVHDFDGQPSLSTEGHSIQT
IQHPPSNRASTETYSTPALLAPSESNATSTTNFPSIPVASTSQPASILAGIGSSHSEGLL
QIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHP
GHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSG
GDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREA
GRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAAGPAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagcaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagttgaaggagaaaaaagatgagttggattctttaataacagcc
ataactacaaatggagctcatcctagtaaatgcgttactatacagagaacattggatgga
agacttcaggtggctggtaggaaaggatttcctcatgtgatctatgcccgcctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatactgtcagtatgcatttgat
ttaaaatgtgatagtgtctgtgtgaatccatatcattatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtactgctccaaatatgttggtgaaggatgaa
tatgttcatgactttgatggacagccgtcgttatccactgaaggacattcaattcaaacc
atccagcatccaccaagtaatcgtgcatcaacagagacatacagcacccctgctctgtta
gccccgtctgagtctaatgctaccagcaccaccaacttccccagcattcctgtggcttcc
acaagtcagcctgccagtatattggcaggcatcggcagcagccatagtgaaggactgttg
cagatagcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagct
acttaccatcataacagcactactacctggactggaagtagaactgcaccatacacacct
aatttgcctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatccc
ggacattactggccagttcacaatgagcttgcattccagcctcccatttccaatcatcct
gctcctgagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagaca
tttaaggttccttcaagctgccctattgttactgttgatggatacgtggacccttctgga
ggagatcgtttttgcttgggtcaactctccaatgtccacaggacagaagccattgagaga
gcaaggttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgg
gtcaggtgccttagcgaccacgcagtctttgtacaaagttattacttggacagagaagct
gggcgtgcacctggagatgctgttcataagatttacccaagtgcatatataaaggtcttt
gatttgcgccagtgtcatcggcagatgcagcagcaggcagccgggccagctgcagccgcc
gcccaggcagcagccgtggccggaaacattcctggcccaggatcagtaggtggaatagct
ccagctatcagtttgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgc
atactcaggatgagttttgtgaaaggctgggggccggattacccaagacagagcatcaaa
gaaacaccttgctggattgagatccacttgcaccgggcgctccagctcctggatgaagtc
cttcacaccatgcctatcgctgacccacagcctttagactga

DBGET integrated database retrieval system