Tupaia chinensis (Chinese tree shrew): 102494532 Help Entry 102494532         CDS       T02978                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04020   Calcium signaling pathway tup04151   PI3K-Akt signaling pathway tup04810   Regulation of actin cytoskeleton tup05200   Pathways in cancer tup05207   Chemical carcinogenesis - receptor activation tup05218   Melanoma tup05224   Breast cancer tup05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102494532 (FGF22)    04014 Ras signaling pathway     102494532 (FGF22)    04015 Rap1 signaling pathway     102494532 (FGF22)    04020 Calcium signaling pathway     102494532 (FGF22)    04151 PI3K-Akt signaling pathway     102494532 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102494532 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102494532 (FGF22)    05207 Chemical carcinogenesis - receptor activation     102494532 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     102494532 (FGF22)    05218 Melanoma     102494532 (FGF22)    05224 Breast cancer     102494532 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102494532 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102494532 (FGF22) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Growth factors (RTK binding)    102494532 (FGF22) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Growth factors/receptors    102494532 (FGF22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  102494532 NCBI-ProteinID:  XP_014440938 LinkDB All DBs Position Un AA seq 198 aa AA seqDB search MAGAQPENGGAAGAPAGCSDAASAGAGEVGRPWEDPGKSLHELSLALPRHPAVPSRVRLK WLGLAWLLLARAPGTPSAPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDPSGRVQGTHWRH GQDSIVEIRAVRVGTVVIKAVHTGFYVAMNRQGRLYGSVSRPPARPMFLALDGRGVPRRG SRTRRHHLSTHFLPVLVS NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggcaggagctcagccagagaacggcggggcagcaggggctccagcagggtgctcggac gctgcctctgctggggcaggtgaggtgggaaggccctgggaagaccctgggaagtccctg cacgagctgagcctggcgctgccacgccacccagcagtcccctcccgggtacgcctgaag tggctgggcctggcctggctgctgctggcccgggcaccggggaccccgagcgcgccgcgg aggccgcgcagctatccgcacctggagggcgacgtgcgctggcggcgcctcttctcctcc acccacttcttcctccgtgtggaccccagcggccgcgtgcagggcacccactggcgccac ggccaggacagcattgttgagatccgtgcagtccgtgtgggcaccgtggtcatcaaggct gtgcacacaggcttctacgtggccatgaaccgccagggccgcctctatgggtcggtgagc cgcccccccgcccggcccatgttcctggcgctggacgggcggggggtgccccggagaggc agccggacacggaggcaccatctgtccacccacttcctgcccgtcctggtctcctga

DBGET integrated database retrieval system