KEGG   Tupaia chinensis (Chinese tree shrew): 102497986Help
Entry
102497986         CDS       T02978                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102497986 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102497986 (KMT5B)
Enzymes [BR:tup01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102497986 (KMT5B)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102497986 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 102497986
NCBI-ProteinID: XP_014440803
LinkDB All DBs
Position
Un
AA seq 884 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQTKLQHTGKDTLKAGKNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFS
HNNPVRFRPVKGRQEELKEVTERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSRSRALTRQSVSRIPA
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEP
KVVLYKNLSIKKDKETEGPAHAAVASGCLTRHAAREHRQHPVRGAHPQGEEGSPCTYITR
RSVRTRTNLREASDTKLEPNTLDGYKNSVIAPCPDSGEQPTPMVQEEELAHETAQKGEAK
YHKNDISVSKKKSRPGKLVKQFAKIEESSPVHDSPRQDSTVPDLVEPGSDQGEHSGTVTV
PVNYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
RRHDSSSKTNDQENDGMSSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSATKLKIQL
KRDEESRGSYPEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTGDSSSSEGDEDDDDY
DDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRRDDQSLRLNA
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaaaccaaattacagcacacggggaaggacaccctg
aaggctggcaaaaacgcagtcgagaggaggtcaagcagatgtaatggtaattcaggattt
gaaggacagagtcgttatgtgccatcttctggaatgtctgccaaggaactctgtgaaaat
gacgaccttgcaaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagtgcttttccttcgaggagctcaagacatttttcaaagtctgacagtttttct
cacaacaaccctgtgagatttcggcctgttaaaggaaggcaagaagaactaaaggaagta
actgaacgttttaagaaagatgagcacttggagaaggccttcaaatgtttgacttcaggt
gaatgggcaaggcactattttctcaacaagaacaaaatgcaggagaaattattcaaagaa
catgtatttatttacttgcgaatgtttgcaactgacagtggatttgaaattttgccttgt
aatagatactcgtcagaacaaaatggagccaaaatagttgcaacgaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagagaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcaactctggcttggtcctgctgcctttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatactgcatgcgtgaaagctctaagagacattgaacctgga
gaagaaatttcttgttattatggagatggtttttttggagaaaacaatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgcttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gatgcagataccactcaggaaaaaaacaatgcaacttctaaccgaaaatcttcagttgga
gtaaagaagaacagcagaagccgagcactaacaaggcaatctgtgtcaagaattccagct
tcttccaactctacctcatctaagctaactcatataaataattccagggtaccaaagaaa
ctgaaaaagcctgcaaagcctttactttcaaagataaaattaagaaatcattgcaagcgg
ctggagcaaaagaatgcttccagaaaactcgaaatgggaaacttagttcttaaggagcct
aaagtagttctgtataaaaatttatccattaaaaaggataaggagacagagggaccagcc
cacgctgcagttgctagcgggtgcttgactagacatgcggcgagagaacacagacaacat
cctgtgagaggtgctcatccacagggtgaggagggctcaccctgcacgtacataaccagg
cggtcagtgaggacaagaacgaatctgagggaggcctctgacaccaagcttgaaccaaat
acattggatggctataaaaacagtgtgatagcaccttgcccagacagtggcgagcagcca
actcccatggtgcaagaagaagagctggctcatgagactgcacagaagggggaagcaaag
tatcataaaaatgatatcagcgtctccaaaaagaagtcacgaccaggaaaacttgtaaaa
cagtttgcaaaaatagaggaatccagtccagtgcatgattcccctagacaagacagcacg
gtgccagacttggtggagcctggctctgaccagggtgagcacagtggcacggtcactgtg
cctgtgaactatacagactgtgctccttcacctgtcggttgttcagttgttacatcagat
agcttcaaaacaaaagacagctttagaactgcaaaaagtaaaaagaaaaggcgaatcaca
aggtatgatgcacagctaattctagaaaataactctgggattcccaaattgactcttcgt
aggcgtcatgatagcagcagcaagacaaatgaccaagagaatgatggaatgagttcttca
aaaatcagcatcaagttaagcaaagaccatgaaaatgataataatctctatgtagcaaag
cttaataatggatttaactcaggatcgggcagtagtgctacaaaactaaaaatccagctg
aaacgggatgaagaaagtagggggtcctatccagaggggcttcatgaaaatggagtgtgc
tgtagtgatccactttctctcctagagtctcgaatggaagtggatgactacagtcagtac
gaggaagaaagtacaggtgattcctcctcttcagagggagatgaggatgatgacgactat
gatgatgactttgaagatgattttattccgcttcctccagctaagcgattgaggctcata
gttgggaaagactccatagatattgacatttcttcaaggagaagagacgatcagtcttta
aggcttaatgcataa

DBGET integrated database retrieval system