KEGG   Tetranychus urticae (two-spotted spider mite): 107366670
Entry
107366670         CDS       T04901                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00230  Purine metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107366670
Enzymes [BR:tut01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107366670
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF4713 MARVEL MIP-T3_C
Other DBs
NCBI-GeneID: 107366670
NCBI-ProteinID: XP_015789780
LinkDB
Position
Unknown
AA seq 1212 aa
MKMKKKFSSNGEEKLKWMMELRMTSPQTGLLATNGRPEYGKSECKSTIKRETTNGRDTSS
LLLQREADLSIDQSGLQRYLPHCVQFAFADKGAEGLYREYYANEKRTDFTTLLSITLIVN
LLLLSLYSIHYTPSKLPQLIVLLSTLVLTCLIYLWTCKWGIQSKPINYSTDPHHVTSSSP
SSSTSSSTSTSSHSLSKRLLRKGGQQRMWTIVPFIVWLIFIAHIICDVTLFSQPRQPSDS
LAFLLLYTFSIYVIYPLRLTIVCILSIAMASLHTIPLLTPSSSSSSFTITDNLLYYQIGA
NIILIIGINLLGLMSFFFYERQQRRAFLETCQSLEVKLVLEEESAEQERLLLSVLPKHVA
AEIRQDLGSMVTGQFKKIYMSRHENVSILFADIVGFTAISSTCSAAELVKTLNELFARFD
KLSDKYHQLRIKILGDCYYCISGAPEQRSDHAVLCVHMGLSMVEAIKSVREETKSCVDMR
VGIHTGGVLAGVLGQKQWQFDVYSRDVELANKMESGGLPGRVHISEKTLSFLNGEFEVTN
GDGASREEAIRLANVQTYFIVRVIKPYPEGTLDAIQQNKGDMTNQVNLGVGGDEGDGEDH
ECIIGSGGEIKNVAEYNARLRHELLNRDNAHNLSDHSYPISLTFRNPAYESQFRNTREIT
GSISLVSLPCTLACSFISYILIGPLTLTLFLVYFISVAILGPTSVASMSTIICKTCPKPL
LALSKAVQAKSWVRLVIATSMILVWIVAHIIANISCNSSYQDDTINEDSESSLSSLLSPF
PSPSTLTSDLPAELNLPPSLSSSFSSFSSSPSYSYSPSHCIPHYLVFFAILGMLAISSLQ
RISHVFKMTFILILGALQIAFNYTLLYQHFTDTTISSTHSASHSPTTTATTATLNQPSSL
SSSSSSLSGSATIETDETSLASTSTSTSSTATTSSWLSQSSTLSIVTLIVAIALYLINRN
CDSMARRLFLWQKEVDEQKKKVEDMRQKNEALVYNILPPHVAIHFLGRRKRDEELYSKSY
EAVGVLFAAMPNFSDFYTEESVNNQGLECLRFLNEVISDYDALLEQDRFRDIIKIKTIGA
TYMAASGLNEEERDEAKSWQHLATLTDFALTLKETLNNINRESFNNFVLRMGINQGPITA
GVIGARKPHFDMWGNTVNVASRMESTGKAGCIQVVEETAKILQEFGFIFEQRGLVSVKGK
GKLMTYYLIGKK
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgaaaatgaaaaagaaattctcttctaatggagaggagaagttaaagtggatgatggag
cttcgaatgaccagcccacagactgggctattggcaactaatggtcgacctgaatatggt
aaatcggagtgcaagtcaacgattaaacgtgaaaccaccaatggtcgagatacatcatct
ttacttctccagcgtgaagctgacctgtcaattgatcaaagtggacttcaacgttacctt
ccccattgtgttcaatttgcatttgctgataaaggtgctgaaggattataccgggaatat
tatgccaatgagaaaaggaccgattttaccaccttactatcaattacgctaattgttaat
cttctccttctatctctttattcaatacattacacgccaagcaagctaccccaattaatt
gtcctcttgtcaacacttgttctcacttgcctcatctatttgtggacatgtaaatgggga
atccaaagtaaacctatcaattattcaactgatcctcatcatgtcacctcatcttctcca
tcatcatcaacatcctcatccacatcaacctcatcccattcattatctaaacgattactc
cggaaagggggacaacaacgtatgtggacaattgtaccctttatagtgtggcttattttc
atagcccatatcatctgtgatgttacccttttctcacaacctaggcaaccaagtgatagt
ctagcatttcttttactttacaccttttcaatttatgtaatatacccgttaagattaaca
attgtgtgcattctttcaattgcaatggcatctttgcatacaattccacttttaacaccc
tcctcctcttcctcctccttcacgattacggataacttattatattatcagattggagca
aatataatattaattattggaatcaaccttttgggtttaatgtctttctttttctatgaa
cgtcaacagcgacgagctttccttgaaacttgccaatcccttgaagttaaacttgtcctc
gaagaggaatcagccgaacaggaaaggctacttttatccgttttaccaaaacacgttgca
gccgagattcgtcaagatttaggttcaatggttactggtcagtttaaaaagatttacatg
tcccgtcacgagaatgtgtcaattttgtttgccgatatcgtcggttttacagcaatcagt
tcaacttgttccgctgcggaactggtgaaaacattgaatgaactgtttgctcgatttgat
aagctttccgataaatatcatcagttgcgaataaaaattttaggcgattgttattattgt
atttcgggtgcacccgaacaacgctctgaccatgcagtcctttgtgttcacatgggcctg
tccatggttgaggccattaaatcggttagagaagagactaaatcctgtgtagacatgaga
gtcggtattcacacgggcggagttttggccggtgttttagggcaaaaacagtggcaattt
gatgtctactcgagagacgtcgagttggccaataaaatggagtctggcggtttacctgga
cgagtccatatttcagagaaaacgttatcctttttaaatggagagtttgaagttacaaat
ggtgatggagcttcacgagaagaagccattagacttgccaatgttcaaacatattttatt
gttagagtaattaaaccatatccagaaggtactttggatgcaatacaacaaaacaaaggt
gatatgacaaaccaagttaatcttggggttggaggtgatgaaggtgatggtgaagatcat
gagtgtatcattggctcaggaggagagataaagaatgtcgctgaatacaatgctcgtctt
cgccatgaactattaaatcgagataatgctcacaatttatcagaccatagttacccaatc
agccttacctttcgtaatccagcctatgagtctcagtttcggaatacccgtgaaattacc
ggaagcatatcactggtttcactgccttgtacacttgcctgttcatttataagttacatt
ttaattggtccattaaccttaaccctgtttttggtctattttatctcggtagccatactt
ggtccaacctcagtagcttccatgtcaaccataatatgcaaaacttgcccaaagcctctt
ctagctctatcaaaagctgtccaagcaaagtcatgggtccgtctagtaatagccacttcc
atgatacttgtttggatagttgctcatatcattgccaatataagttgtaattctagttat
caagatgacaccatcaatgaagactccgagtcttcattatcatccttattatcgccattt
ccatctccatcaacgttaacatcagatcttccggcggaactcaatcttccaccttctcta
tcttcctctttctcatccttttcatcttcaccctcctattcatattcaccaagccactgt
attccccattatctggtattttttgcaatactgggtatgttggcgataagctcactccaa
aggatatctcatgttttcaagatgacctttattttaattcttggagctcttcaaatagcc
ttcaattataccctgttgtatcagcatttcaccgatacaacaataagctcaacccattca
gcatcccattcacccacaacaacagcaacaacagcaactcttaatcaaccatccagccta
tcatcttcatcatcaagtctatccggttcagccaccattgaaaccgatgaaacctcttta
gcctcaacctcaacctcaacctcatccacagctacaacctcaagctggctcagtcaatca
tcaaccctatccatagtaacccttatcgttgccattgcactttacctgattaaccgtaat
tgtgattcaatggctcgtcgtcttttcctttggcagaaagaggttgatgaacaaaagaag
aaggttgaagatatgagacaaaaaaatgaagcacttgtctataacattttacctccgcac
gttgccattcactttcttggtcgccgtaaacgagacgaagagctttactctaaatcctat
gaagcggttggcgtccttttcgctgcaatgcccaatttttccgatttttataccgaagag
tcagtcaataatcaaggcttggaatgtttacgtttccttaatgaggttatttctgattac
gatgctttacttgaacaagatcgtttccgtgatataattaaaattaaaaccattggagcc
acttacatggctgcttcaggtttaaatgaagaggaacgagatgaagctaaaagttggcaa
catttagcaactttaactgattttgcattaactttaaaggaaactcttaataatattaat
agagaaagttttaataattttgtccttcgaatgggtattaaccaaggaccaataactgcc
ggggtaattggagcaaggaaacctcactttgatatgtggggtaacactgtcaatgtcgct
agtcgtatggaaagcacaggtaaagctggctgtattcaggttgtcgaagaaactgccaaa
atattgcaagaatttggtttcatttttgaacaacgaggtttagtttctgttaaaggaaaa
ggcaaactcatgacctactacctgattgggaagaagtga

DBGET integrated database retrieval system